SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_2693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_2693
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.31e-36
Family Chaperone J-domain 0.00009
Further Details:      
 
Domain Number 2 Region: 259-344
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.62e-23
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 132-211
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 4.19e-19
Family DnaJ/Hsp40 cysteine-rich domain 0.00028
Further Details:      
 
Domain Number 4 Region: 111-136,213-262
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.71e-19
Family HSP40/DnaJ peptide-binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_2693
Sequence length 373
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MTTGAKRDYYEVLGVSRSATPDEIKKAFRRLARQYHPDVNKSPDAEAKFKEINEAYEVLS
DEQKRAMYDRFGHNPPGFGGMGADPFGGVDPFSSIFDAFFGAAGVGRSTRGPMRGADLRY
TLRLTFEEAVFGTEKEIEFRRLETCPACRGSGAEPGTEPTRCPRCGGTGEIRQRAPIFNM
VTVTTCDVCGGTGYVIPIPCRECRGEGRVRQTRRITVRVPAGVDGSQQIRISGEGEAGPR
GGPPGNLYVALDIQPHPIFEREGNDIILNLTINVAQAALGGEVSVPTLEGTERLRLPPGT
QHGQTFRLHGKGVPYLRQQGRGDQIVVIRVEIPTRLTDQQRRLFQELAQTFSSHDHDHGD
KGLFGHIKDALGL
Download sequence
Identical sequences B8G4T5
WP_015941418.1.86148 326427.Cagg_2693 gi|219849564|ref|YP_002463997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]