SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_3711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_3711
Domain Number 1 Region: 295-437
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.72e-31
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 202-294
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_3711
Sequence length 510
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MTELLWAVIALLLGLVGGAGIGIWWANNGASSLVQRKAAEARLLIEEARSQQKEILLQAK
DEALRIRNEAEAELRESRQSLQKQEERLQRKEENIDRKLEGIERRERLIQQRERQIEQLA
QEAERLKRQQAQELERISQLSRDEARSIILAEVERETREDAARRIRELEQQTKEEADKIA
RKIIGLAIQRCASDYVAEMTVSTVNLPSEELKGRIIGREGRNIRAFEQITGVDIIVDDTP
EAVTLSCHDPVRREVARVALLKLLKDGRIHPSRIEEVVHKTQLEIEQIMREEGERVAYEA
NVQGLHPDLIKLLGRLKYRTSYGQNVLQHSLECALLAAHMAAELGANVNIAKTAALLHDI
GKAVDHEVQGPHALIGAEIARRLGRSPAIVHAIAAHHYDEEPQTVEAFLVIAADAISGAR
PGARRETLDLYIKRLEALETVATSFPGVQRAFAVQAGREVRVMVQPDQIDDLGSIHLARN
VAKKIEESLQYPGQIKVTIIRETRAVDYAR
Download sequence
Identical sequences B8GAH2
326427.Cagg_3711 gi|219850550|ref|YP_002464983.1| WP_015942392.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]