SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326442.PSHAa0503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326442.PSHAa0503
Domain Number 1 Region: 6-154
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 3.53e-40
Family DR1885-like metal-binding protein 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326442.PSHAa0503
Sequence length 169
Comment (Pseudoalteromonas haloplanktis TAC125)
Sequence
MIKQCISIVLVSVLSLFSSSSMAHSGHEHDADVAIIKVSNAQVREFLPATTSSVGYLSII
NHSDTVATLTKATIDGLGRVEIHEHSHVDGMMKMQKVESLTINAHQQIDFKPGGYHLMIF
EPQEPLKVGQQRKLTLYFSDGNRVFTNAQVVSLASQAEQSQASKQHTHH
Download sequence
Identical sequences Q3IG88
WP_011327206.1.36504 gi|77359461|ref|YP_339036.1| 326442.PSHAa0503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]