SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326442.PSHAa0610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326442.PSHAa0610
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-17
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326442.PSHAa0610
Sequence length 218
Comment (Pseudoalteromonas haloplanktis TAC125)
Sequence
MFQYHFSSYLVEQLLTFAGSSYQQSKKEILIQQDQPLTKLVLVRSGTVSFSYDVGNGRRL
LLGQLDCNNTLIGEIEALNNNPCIYTVTCFSDVTYNLIELKHWRALLLEKPELSLYTAQT
IAAKFQENQKINLDKLLLPLSYNIAKDCLLRAENNNPTLLRAYPTVNAEAERFATTERAY
RRVVTELVEKSLVQRSTQGLLAVDIPRLSQYVDSFAQL
Download sequence
Identical sequences A0A221IGN6 Q3ILK2
2001495473 WP_011327309.1.36504 WP_011327309.1.42639 326442.PSHAa0610 gi|77359564|ref|YP_339139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]