SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326442.PSHAa1668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326442.PSHAa1668
Domain Number - Region: 37-100
Classification Level Classification E-value
Superfamily POZ domain 0.0369
Family Tetramerization domain of potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326442.PSHAa1668
Sequence length 176
Comment (Pseudoalteromonas haloplanktis TAC125)
Sequence
MLQASKQWQWISCAKKNRLLLDLNEDMQLCTPYKLRQLTDSTFKNPYFSLEDAAFYEQVY
QYLVQFKLWNPAQLCQISLNATAVKFQLKPVLAKSWFFEQYTGSTPSTEAVINLTSKAQS
GEFLIVEHSSDASVCINLSENFQLDDNLSLVQFEAIRVLNNRVHPLLNQHIHSKIA
Download sequence
Identical sequences Q3IGZ2
326442.PSHAa1668 gi|77360609|ref|YP_340184.1| WP_011328346.1.36504 WP_011328346.1.42639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]