SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_2708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_2708
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily ACP-like 0.000000000327
Family Acyl-carrier protein (ACP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_2708
Sequence length 79
Comment (Acaryochloris marina MBIC11017)
Sequence
MAENGVQDRVKLVFSDILDIDLQTISDDLGPDNCDSWDSMNNLRLITALEEEFSISFSME
EISSMVDISRVFELIESKS
Download sequence
Identical sequences B0C824
WP_012163157.1.67183 329726.AM1_2708 gi|158335850|ref|YP_001517024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]