SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_3111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_3111
Domain Number 1 Region: 12-181
Classification Level Classification E-value
Superfamily Macro domain-like 2.02e-32
Family Macro domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_3111
Sequence length 202
Comment (Acaryochloris marina MBIC11017)
Sequence
MQLTDLQLILVDPIPELCEQWQLKFEGQSQVDIINGRFEDLSQYDCMVSAGNSFGLMDGG
VDGAITRYFGLDLMDRVQTCILQHFRGEQPVGTAFIIETHHPQHPFLAHTPTMRVPMPIA
TTDNVYQAMWAMLLAIWHHNQSHAQPIRSVACPGLGTATGQMPFERAAKQMALAYKNFWH
PPEMISWPFAITRHNAIGAGGG
Download sequence
Identical sequences B0CDN8
WP_012163535.1.67183 329726.AM1_3111 gi|158336249|ref|YP_001517423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]