SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331112.EcHS_A3356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331112.EcHS_A3356
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 226-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.15e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-23
Family Cold shock DNA-binding domain-like 0.0000219
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 331112.EcHS_A3356
Sequence length 711
Comment (Escherichia coli HS)
Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVA
GTEAAVLMVESEAQLLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNE
ALNARVAALAEARLSDAYRITDKQERYAQVDVIKSETIATLLAEDETLDENELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDK
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSD
ILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAAAPEAPAAEQGE
Download sequence
Identical sequences A0A024L8I7 A0A069XS37 A0A070SX08 A0A0E0U3R4 A0A0E1M1X0 A0A0M7N178 A0A125WZ18 A0A140N5F4 A0A142H738 A0A235V595 A0A238BBE9 A8A4Y0 B1XGX6 C4ZSQ5 H4UPM0 I0VVG2 L2VGW8 M9GAR9 P05055 S1IPV1 T9CC40 V2RRN6 W1ATQ2
gi|387823500|ref|YP_003000740.2| NP_417633.4.90541 WP_001295554.1.100085 WP_001295554.1.100111 WP_001295554.1.100251 WP_001295554.1.10034 WP_001295554.1.100441 WP_001295554.1.100451 WP_001295554.1.100487 WP_001295554.1.100496 WP_001295554.1.10051 WP_001295554.1.100573 WP_001295554.1.100614 WP_001295554.1.100753 WP_001295554.1.100824 WP_001295554.1.100868 WP_001295554.1.100966 WP_001295554.1.101033 WP_001295554.1.101096 WP_001295554.1.101158 WP_001295554.1.101186 WP_001295554.1.101282 WP_001295554.1.101387 WP_001295554.1.101654 WP_001295554.1.10173 WP_001295554.1.101737 WP_001295554.1.101747 WP_001295554.1.10187 WP_001295554.1.10188 WP_001295554.1.101908 WP_001295554.1.10233 WP_001295554.1.10252 WP_001295554.1.10304 WP_001295554.1.1040 WP_001295554.1.10417 WP_001295554.1.10491 WP_001295554.1.10496 WP_001295554.1.1058 WP_001295554.1.10729 WP_001295554.1.10833 WP_001295554.1.10989 WP_001295554.1.11032 WP_001295554.1.11047 WP_001295554.1.11118 WP_001295554.1.1113 WP_001295554.1.112 WP_001295554.1.11241 WP_001295554.1.11436 WP_001295554.1.1168 WP_001295554.1.11699 WP_001295554.1.11955 WP_001295554.1.11982 WP_001295554.1.12060 WP_001295554.1.1212 WP_001295554.1.12320 WP_001295554.1.12458 WP_001295554.1.12468 WP_001295554.1.12542 WP_001295554.1.12558 WP_001295554.1.12582 WP_001295554.1.12594 WP_001295554.1.12675 WP_001295554.1.12680 WP_001295554.1.127 WP_001295554.1.12756 WP_001295554.1.12914 WP_001295554.1.13002 WP_001295554.1.13031 WP_001295554.1.1312 WP_001295554.1.13136 WP_001295554.1.13176 WP_001295554.1.13239 WP_001295554.1.13258 WP_001295554.1.13281 WP_001295554.1.13290 WP_001295554.1.13333 WP_001295554.1.1345 WP_001295554.1.13585 WP_001295554.1.13608 WP_001295554.1.13618 WP_001295554.1.13877 WP_001295554.1.13949 WP_001295554.1.13974 WP_001295554.1.14030 WP_001295554.1.1419 WP_001295554.1.14199 WP_001295554.1.14277 WP_001295554.1.1438 WP_001295554.1.14468 WP_001295554.1.14501 WP_001295554.1.14529 WP_001295554.1.14600 WP_001295554.1.1461 WP_001295554.1.14661 WP_001295554.1.14811 WP_001295554.1.14833 WP_001295554.1.14871 WP_001295554.1.14992 WP_001295554.1.1512 WP_001295554.1.15259 WP_001295554.1.153 WP_001295554.1.15377 WP_001295554.1.15576 WP_001295554.1.15645 WP_001295554.1.15740 WP_001295554.1.15747 WP_001295554.1.1588 WP_001295554.1.16086 WP_001295554.1.1609 WP_001295554.1.16102 WP_001295554.1.16111 WP_001295554.1.16171 WP_001295554.1.16294 WP_001295554.1.1634 WP_001295554.1.16435 WP_001295554.1.16500 WP_001295554.1.16532 WP_001295554.1.16541 WP_001295554.1.16577 WP_001295554.1.16612 WP_001295554.1.16700 WP_001295554.1.16715 WP_001295554.1.16721 WP_001295554.1.17017 WP_001295554.1.17018 WP_001295554.1.17084 WP_001295554.1.17087 WP_001295554.1.1710 WP_001295554.1.17114 WP_001295554.1.17123 WP_001295554.1.17216 WP_001295554.1.17290 WP_001295554.1.17360 WP_001295554.1.17432 WP_001295554.1.17534 WP_001295554.1.1755 WP_001295554.1.17577 WP_001295554.1.1763 WP_001295554.1.17802 WP_001295554.1.17889 WP_001295554.1.17952 WP_001295554.1.18133 WP_001295554.1.18134 WP_001295554.1.18229 WP_001295554.1.18329 WP_001295554.1.18381 WP_001295554.1.18402 WP_001295554.1.18482 WP_001295554.1.18550 WP_001295554.1.18588 WP_001295554.1.18858 WP_001295554.1.19100 WP_001295554.1.19150 WP_001295554.1.19194 WP_001295554.1.19205 WP_001295554.1.19206 WP_001295554.1.19277 WP_001295554.1.193 WP_001295554.1.19313 WP_001295554.1.19557 WP_001295554.1.1963 WP_001295554.1.19644 WP_001295554.1.19684 WP_001295554.1.19691 WP_001295554.1.1982 WP_001295554.1.19878 WP_001295554.1.19889 WP_001295554.1.19940 WP_001295554.1.19957 WP_001295554.1.19994 WP_001295554.1.20133 WP_001295554.1.20151 WP_001295554.1.20164 WP_001295554.1.20170 WP_001295554.1.20183 WP_001295554.1.20308 WP_001295554.1.20331 WP_001295554.1.20445 WP_001295554.1.20506 WP_001295554.1.20515 WP_001295554.1.20536 WP_001295554.1.2063 WP_001295554.1.20638 WP_001295554.1.20737 WP_001295554.1.20943 WP_001295554.1.20958 WP_001295554.1.20982 WP_001295554.1.2100 WP_001295554.1.21017 WP_001295554.1.21020 WP_001295554.1.21033 WP_001295554.1.21057 WP_001295554.1.21122 WP_001295554.1.21251 WP_001295554.1.21573 WP_001295554.1.21661 WP_001295554.1.21771 WP_001295554.1.21823 WP_001295554.1.21915 WP_001295554.1.22060 WP_001295554.1.22113 WP_001295554.1.22363 WP_001295554.1.22450 WP_001295554.1.22574 WP_001295554.1.22632 WP_001295554.1.22649 WP_001295554.1.22669 WP_001295554.1.22690 WP_001295554.1.22765 WP_001295554.1.22830 WP_001295554.1.22878 WP_001295554.1.22885 WP_001295554.1.2300 WP_001295554.1.23044 WP_001295554.1.23090 WP_001295554.1.23290 WP_001295554.1.23376 WP_001295554.1.23378 WP_001295554.1.23511 WP_001295554.1.23549 WP_001295554.1.23812 WP_001295554.1.23898 WP_001295554.1.23945 WP_001295554.1.24089 WP_001295554.1.2428 WP_001295554.1.24304 WP_001295554.1.24316 WP_001295554.1.24362 WP_001295554.1.24499 WP_001295554.1.24876 WP_001295554.1.24899 WP_001295554.1.24960 WP_001295554.1.25042 WP_001295554.1.25085 WP_001295554.1.25141 WP_001295554.1.25183 WP_001295554.1.25203 WP_001295554.1.25312 WP_001295554.1.25324 WP_001295554.1.25525 WP_001295554.1.25643 WP_001295554.1.25713 WP_001295554.1.25832 WP_001295554.1.25843 WP_001295554.1.25996 WP_001295554.1.26048 WP_001295554.1.26100 WP_001295554.1.26379 WP_001295554.1.26403 WP_001295554.1.26480 WP_001295554.1.26588 WP_001295554.1.26609 WP_001295554.1.27057 WP_001295554.1.2712 WP_001295554.1.27134 WP_001295554.1.27260 WP_001295554.1.27451 WP_001295554.1.27560 WP_001295554.1.27611 WP_001295554.1.27742 WP_001295554.1.27774 WP_001295554.1.27879 WP_001295554.1.27923 WP_001295554.1.27971 WP_001295554.1.28128 WP_001295554.1.28268 WP_001295554.1.28271 WP_001295554.1.28371 WP_001295554.1.28509 WP_001295554.1.28544 WP_001295554.1.28662 WP_001295554.1.28697 WP_001295554.1.28711 WP_001295554.1.28760 WP_001295554.1.28809 WP_001295554.1.28919 WP_001295554.1.28994 WP_001295554.1.290 WP_001295554.1.29016 WP_001295554.1.29026 WP_001295554.1.29061 WP_001295554.1.29150 WP_001295554.1.29221 WP_001295554.1.29239 WP_001295554.1.2942 WP_001295554.1.2945 WP_001295554.1.29746 WP_001295554.1.2995 WP_001295554.1.29967 WP_001295554.1.30004 WP_001295554.1.30231 WP_001295554.1.30247 WP_001295554.1.30452 WP_001295554.1.30472 WP_001295554.1.30479 WP_001295554.1.30497 WP_001295554.1.30546 WP_001295554.1.30554 WP_001295554.1.30630 WP_001295554.1.30733 WP_001295554.1.30749 WP_001295554.1.30783 WP_001295554.1.31000 WP_001295554.1.31089 WP_001295554.1.31142 WP_001295554.1.31211 WP_001295554.1.31295 WP_001295554.1.31379 WP_001295554.1.31407 WP_001295554.1.31421 WP_001295554.1.31506 WP_001295554.1.3169 WP_001295554.1.3181 WP_001295554.1.31833 WP_001295554.1.31835 WP_001295554.1.31839 WP_001295554.1.31928 WP_001295554.1.31978 WP_001295554.1.32093 WP_001295554.1.32121 WP_001295554.1.32143 WP_001295554.1.32394 WP_001295554.1.32479 WP_001295554.1.32509 WP_001295554.1.32661 WP_001295554.1.32815 WP_001295554.1.32903 WP_001295554.1.32984 WP_001295554.1.33238 WP_001295554.1.33244 WP_001295554.1.334 WP_001295554.1.33422 WP_001295554.1.33424 WP_001295554.1.33526 WP_001295554.1.33545 WP_001295554.1.33565 WP_001295554.1.33648 WP_001295554.1.33736 WP_001295554.1.33751 WP_001295554.1.33799 WP_001295554.1.33879 WP_001295554.1.33888 WP_001295554.1.33952 WP_001295554.1.33974 WP_001295554.1.3401 WP_001295554.1.34124 WP_001295554.1.342 WP_001295554.1.34277 WP_001295554.1.34332 WP_001295554.1.34363 WP_001295554.1.34525 WP_001295554.1.34532 WP_001295554.1.34538 WP_001295554.1.347 WP_001295554.1.34727 WP_001295554.1.34982 WP_001295554.1.34990 WP_001295554.1.34993 WP_001295554.1.35195 WP_001295554.1.35204 WP_001295554.1.35211 WP_001295554.1.35360 WP_001295554.1.35466 WP_001295554.1.35704 WP_001295554.1.35904 WP_001295554.1.36164 WP_001295554.1.3620 WP_001295554.1.36332 WP_001295554.1.36334 WP_001295554.1.36453 WP_001295554.1.36496 WP_001295554.1.36610 WP_001295554.1.36627 WP_001295554.1.36739 WP_001295554.1.36746 WP_001295554.1.36747 WP_001295554.1.36833 WP_001295554.1.37057 WP_001295554.1.37122 WP_001295554.1.3723 WP_001295554.1.37261 WP_001295554.1.37433 WP_001295554.1.37445 WP_001295554.1.37485 WP_001295554.1.37576 WP_001295554.1.37588 WP_001295554.1.37745 WP_001295554.1.37750 WP_001295554.1.37817 WP_001295554.1.3788 WP_001295554.1.37897 WP_001295554.1.37964 WP_001295554.1.38080 WP_001295554.1.38085 WP_001295554.1.38105 WP_001295554.1.3811 WP_001295554.1.3815 WP_001295554.1.38155 WP_001295554.1.38182 WP_001295554.1.38211 WP_001295554.1.38323 WP_001295554.1.38371 WP_001295554.1.38485 WP_001295554.1.38533 WP_001295554.1.38544 WP_001295554.1.38636 WP_001295554.1.38843 WP_001295554.1.38950 WP_001295554.1.38956 WP_001295554.1.39164 WP_001295554.1.39167 WP_001295554.1.39365 WP_001295554.1.39367 WP_001295554.1.39430 WP_001295554.1.39541 WP_001295554.1.39594 WP_001295554.1.39829 WP_001295554.1.39938 WP_001295554.1.39961 WP_001295554.1.39966 WP_001295554.1.39970 WP_001295554.1.39992 WP_001295554.1.40013 WP_001295554.1.40016 WP_001295554.1.40192 WP_001295554.1.40212 WP_001295554.1.40218 WP_001295554.1.40317 WP_001295554.1.40389 WP_001295554.1.40445 WP_001295554.1.40499 WP_001295554.1.40524 WP_001295554.1.40548 WP_001295554.1.406 WP_001295554.1.40712 WP_001295554.1.40833 WP_001295554.1.40898 WP_001295554.1.40912 WP_001295554.1.40965 WP_001295554.1.41206 WP_001295554.1.41363 WP_001295554.1.41484 WP_001295554.1.41530 WP_001295554.1.41621 WP_001295554.1.41654 WP_001295554.1.41782 WP_001295554.1.41813 WP_001295554.1.41900 WP_001295554.1.41960 WP_001295554.1.42159 WP_001295554.1.42209 WP_001295554.1.42214 WP_001295554.1.42318 WP_001295554.1.42376 WP_001295554.1.4242 WP_001295554.1.42432 WP_001295554.1.42547 WP_001295554.1.42632 WP_001295554.1.42770 WP_001295554.1.4282 WP_001295554.1.42879 WP_001295554.1.42891 WP_001295554.1.4290 WP_001295554.1.42936 WP_001295554.1.42987 WP_001295554.1.42989 WP_001295554.1.43035 WP_001295554.1.4306 WP_001295554.1.43174 WP_001295554.1.43270 WP_001295554.1.43473 WP_001295554.1.43489 WP_001295554.1.43622 WP_001295554.1.43925 WP_001295554.1.44088 WP_001295554.1.44096 WP_001295554.1.44115 WP_001295554.1.44162 WP_001295554.1.44166 WP_001295554.1.44201 WP_001295554.1.44211 WP_001295554.1.44324 WP_001295554.1.44365 WP_001295554.1.44458 WP_001295554.1.44558 WP_001295554.1.44610 WP_001295554.1.44724 WP_001295554.1.44821 WP_001295554.1.44849 WP_001295554.1.44854 WP_001295554.1.44923 WP_001295554.1.44960 WP_001295554.1.44970 WP_001295554.1.44980 WP_001295554.1.45028 WP_001295554.1.45043 WP_001295554.1.45208 WP_001295554.1.45313 WP_001295554.1.45329 WP_001295554.1.45440 WP_001295554.1.4549 WP_001295554.1.45595 WP_001295554.1.4570 WP_001295554.1.4574 WP_001295554.1.45741 WP_001295554.1.45752 WP_001295554.1.4593 WP_001295554.1.45933 WP_001295554.1.46026 WP_001295554.1.46115 WP_001295554.1.4613 WP_001295554.1.46186 WP_001295554.1.46257 WP_001295554.1.46325 WP_001295554.1.46329 WP_001295554.1.46441 WP_001295554.1.46573 WP_001295554.1.4670 WP_001295554.1.46802 WP_001295554.1.46820 WP_001295554.1.46909 WP_001295554.1.46932 WP_001295554.1.47028 WP_001295554.1.47038 WP_001295554.1.47048 WP_001295554.1.47156 WP_001295554.1.47224 WP_001295554.1.47322 WP_001295554.1.47401 WP_001295554.1.47414 WP_001295554.1.47496 WP_001295554.1.47634 WP_001295554.1.47646 WP_001295554.1.47673 WP_001295554.1.4772 WP_001295554.1.47734 WP_001295554.1.47740 WP_001295554.1.47764 WP_001295554.1.47765 WP_001295554.1.47791 WP_001295554.1.48048 WP_001295554.1.48080 WP_001295554.1.48096 WP_001295554.1.48111 WP_001295554.1.48194 WP_001295554.1.48203 WP_001295554.1.48290 WP_001295554.1.48353 WP_001295554.1.48371 WP_001295554.1.48477 WP_001295554.1.48522 WP_001295554.1.486 WP_001295554.1.4871 WP_001295554.1.48847 WP_001295554.1.48860 WP_001295554.1.48953 WP_001295554.1.48974 WP_001295554.1.49009 WP_001295554.1.49363 WP_001295554.1.49531 WP_001295554.1.49537 WP_001295554.1.49621 WP_001295554.1.49645 WP_001295554.1.49661 WP_001295554.1.497 WP_001295554.1.49722 WP_001295554.1.49733 WP_001295554.1.49768 WP_001295554.1.49879 WP_001295554.1.49883 WP_001295554.1.49900 WP_001295554.1.50006 WP_001295554.1.50008 WP_001295554.1.50078 WP_001295554.1.5017 WP_001295554.1.50266 WP_001295554.1.5056 WP_001295554.1.50579 WP_001295554.1.5067 WP_001295554.1.50715 WP_001295554.1.50717 WP_001295554.1.5095 WP_001295554.1.5106 WP_001295554.1.51172 WP_001295554.1.51248 WP_001295554.1.51325 WP_001295554.1.51380 WP_001295554.1.51425 WP_001295554.1.51441 WP_001295554.1.5146 WP_001295554.1.51495 WP_001295554.1.51539 WP_001295554.1.51548 WP_001295554.1.51552 WP_001295554.1.51587 WP_001295554.1.51607 WP_001295554.1.51784 WP_001295554.1.51968 WP_001295554.1.52002 WP_001295554.1.52020 WP_001295554.1.52076 WP_001295554.1.52127 WP_001295554.1.52135 WP_001295554.1.52186 WP_001295554.1.52211 WP_001295554.1.52214 WP_001295554.1.52243 WP_001295554.1.52305 WP_001295554.1.52378 WP_001295554.1.52399 WP_001295554.1.52421 WP_001295554.1.52492 WP_001295554.1.52544 WP_001295554.1.52558 WP_001295554.1.5265 WP_001295554.1.52774 WP_001295554.1.52780 WP_001295554.1.52844 WP_001295554.1.52853 WP_001295554.1.52895 WP_001295554.1.53012 WP_001295554.1.53020 WP_001295554.1.53095 WP_001295554.1.53110 WP_001295554.1.53327 WP_001295554.1.53377 WP_001295554.1.53428 WP_001295554.1.53594 WP_001295554.1.53645 WP_001295554.1.53769 WP_001295554.1.53931 WP_001295554.1.53966 WP_001295554.1.53972 WP_001295554.1.54002 WP_001295554.1.54328 WP_001295554.1.54329 WP_001295554.1.54344 WP_001295554.1.54463 WP_001295554.1.54476 WP_001295554.1.54507 WP_001295554.1.54602 WP_001295554.1.54605 WP_001295554.1.54617 WP_001295554.1.54620 WP_001295554.1.54625 WP_001295554.1.5470 WP_001295554.1.54981 WP_001295554.1.55003 WP_001295554.1.55005 WP_001295554.1.55112 WP_001295554.1.55123 WP_001295554.1.55134 WP_001295554.1.55203 WP_001295554.1.55226 WP_001295554.1.55425 WP_001295554.1.55551 WP_001295554.1.55556 WP_001295554.1.55571 WP_001295554.1.55574 WP_001295554.1.55629 WP_001295554.1.55676 WP_001295554.1.55720 WP_001295554.1.55825 WP_001295554.1.55868 WP_001295554.1.561 WP_001295554.1.5614 WP_001295554.1.56164 WP_001295554.1.56197 WP_001295554.1.56285 WP_001295554.1.56786 WP_001295554.1.56830 WP_001295554.1.56846 WP_001295554.1.56932 WP_001295554.1.56934 WP_001295554.1.56978 WP_001295554.1.56980 WP_001295554.1.57181 WP_001295554.1.57386 WP_001295554.1.57401 WP_001295554.1.57403 WP_001295554.1.57410 WP_001295554.1.57414 WP_001295554.1.57538 WP_001295554.1.57719 WP_001295554.1.57846 WP_001295554.1.5786 WP_001295554.1.57904 WP_001295554.1.58060 WP_001295554.1.58080 WP_001295554.1.5810 WP_001295554.1.58163 WP_001295554.1.58232 WP_001295554.1.58316 WP_001295554.1.58384 WP_001295554.1.58401 WP_001295554.1.5842 WP_001295554.1.58420 WP_001295554.1.58429 WP_001295554.1.58475 WP_001295554.1.58837 WP_001295554.1.58867 WP_001295554.1.58940 WP_001295554.1.58951 WP_001295554.1.58958 WP_001295554.1.58976 WP_001295554.1.59024 WP_001295554.1.59026 WP_001295554.1.59047 WP_001295554.1.59306 WP_001295554.1.59407 WP_001295554.1.59513 WP_001295554.1.59533 WP_001295554.1.59553 WP_001295554.1.59615 WP_001295554.1.5965 WP_001295554.1.59737 WP_001295554.1.59912 WP_001295554.1.59989 WP_001295554.1.59998 WP_001295554.1.6002 WP_001295554.1.60031 WP_001295554.1.60067 WP_001295554.1.60151 WP_001295554.1.60343 WP_001295554.1.60477 WP_001295554.1.60498 WP_001295554.1.60550 WP_001295554.1.60576 WP_001295554.1.6061 WP_001295554.1.6066 WP_001295554.1.60717 WP_001295554.1.60895 WP_001295554.1.60901 WP_001295554.1.61005 WP_001295554.1.6106 WP_001295554.1.61096 WP_001295554.1.61102 WP_001295554.1.61170 WP_001295554.1.61181 WP_001295554.1.61241 WP_001295554.1.61505 WP_001295554.1.61517 WP_001295554.1.61663 WP_001295554.1.61770 WP_001295554.1.61822 WP_001295554.1.61858 WP_001295554.1.61949 WP_001295554.1.62099 WP_001295554.1.62612 WP_001295554.1.62642 WP_001295554.1.62668 WP_001295554.1.62735 WP_001295554.1.62787 WP_001295554.1.62812 WP_001295554.1.62840 WP_001295554.1.62989 WP_001295554.1.63167 WP_001295554.1.63177 WP_001295554.1.6323 WP_001295554.1.63246 WP_001295554.1.6337 WP_001295554.1.63370 WP_001295554.1.63453 WP_001295554.1.63478 WP_001295554.1.63721 WP_001295554.1.64040 WP_001295554.1.64080 WP_001295554.1.6416 WP_001295554.1.64285 WP_001295554.1.6431 WP_001295554.1.64353 WP_001295554.1.64448 WP_001295554.1.647 WP_001295554.1.64749 WP_001295554.1.64784 WP_001295554.1.64789 WP_001295554.1.6499 WP_001295554.1.65040 WP_001295554.1.65179 WP_001295554.1.65256 WP_001295554.1.65271 WP_001295554.1.65353 WP_001295554.1.65408 WP_001295554.1.65415 WP_001295554.1.65912 WP_001295554.1.66050 WP_001295554.1.66104 WP_001295554.1.66127 WP_001295554.1.66251 WP_001295554.1.66280 WP_001295554.1.66327 WP_001295554.1.6635 WP_001295554.1.66387 WP_001295554.1.66389 WP_001295554.1.66395 WP_001295554.1.66501 WP_001295554.1.6654 WP_001295554.1.66559 WP_001295554.1.66579 WP_001295554.1.66624 WP_001295554.1.66644 WP_001295554.1.6665 WP_001295554.1.66700 WP_001295554.1.66719 WP_001295554.1.66849 WP_001295554.1.66933 WP_001295554.1.67021 WP_001295554.1.67022 WP_001295554.1.67026 WP_001295554.1.67137 WP_001295554.1.67200 WP_001295554.1.67272 WP_001295554.1.67293 WP_001295554.1.67415 WP_001295554.1.67538 WP_001295554.1.67553 WP_001295554.1.67660 WP_001295554.1.67732 WP_001295554.1.67787 WP_001295554.1.67853 WP_001295554.1.67861 WP_001295554.1.67990 WP_001295554.1.68008 WP_001295554.1.6802 WP_001295554.1.6803 WP_001295554.1.68170 WP_001295554.1.68215 WP_001295554.1.68283 WP_001295554.1.68396 WP_001295554.1.68534 WP_001295554.1.68697 WP_001295554.1.68711 WP_001295554.1.6877 WP_001295554.1.68797 WP_001295554.1.68865 WP_001295554.1.68989 WP_001295554.1.69033 WP_001295554.1.69127 WP_001295554.1.6916 WP_001295554.1.6923 WP_001295554.1.69247 WP_001295554.1.69258 WP_001295554.1.69261 WP_001295554.1.69303 WP_001295554.1.69305 WP_001295554.1.6945 WP_001295554.1.69473 WP_001295554.1.69646 WP_001295554.1.69803 WP_001295554.1.69972 WP_001295554.1.70063 WP_001295554.1.70370 WP_001295554.1.70407 WP_001295554.1.70767 WP_001295554.1.70880 WP_001295554.1.71024 WP_001295554.1.71042 WP_001295554.1.71159 WP_001295554.1.71199 WP_001295554.1.71229 WP_001295554.1.71272 WP_001295554.1.71285 WP_001295554.1.71312 WP_001295554.1.71315 WP_001295554.1.71323 WP_001295554.1.71397 WP_001295554.1.71409 WP_001295554.1.71480 WP_001295554.1.71632 WP_001295554.1.71690 WP_001295554.1.71783 WP_001295554.1.71837 WP_001295554.1.71856 WP_001295554.1.71938 WP_001295554.1.71944 WP_001295554.1.71975 WP_001295554.1.71987 WP_001295554.1.71993 WP_001295554.1.72033 WP_001295554.1.7205 WP_001295554.1.72157 WP_001295554.1.72184 WP_001295554.1.72237 WP_001295554.1.72279 WP_001295554.1.72337 WP_001295554.1.72397 WP_001295554.1.72431 WP_001295554.1.72485 WP_001295554.1.72511 WP_001295554.1.72537 WP_001295554.1.72544 WP_001295554.1.72606 WP_001295554.1.72745 WP_001295554.1.72747 WP_001295554.1.72910 WP_001295554.1.72947 WP_001295554.1.7307 WP_001295554.1.73085 WP_001295554.1.73129 WP_001295554.1.73217 WP_001295554.1.73292 WP_001295554.1.73295 WP_001295554.1.73385 WP_001295554.1.73524 WP_001295554.1.73565 WP_001295554.1.73604 WP_001295554.1.73717 WP_001295554.1.73835 WP_001295554.1.73843 WP_001295554.1.73844 WP_001295554.1.73859 WP_001295554.1.73942 WP_001295554.1.7411 WP_001295554.1.74123 WP_001295554.1.74184 WP_001295554.1.74309 WP_001295554.1.74365 WP_001295554.1.74445 WP_001295554.1.74520 WP_001295554.1.74528 WP_001295554.1.7461 WP_001295554.1.74625 WP_001295554.1.74652 WP_001295554.1.74691 WP_001295554.1.74713 WP_001295554.1.7475 WP_001295554.1.74860 WP_001295554.1.75139 WP_001295554.1.75145 WP_001295554.1.75149 WP_001295554.1.75243 WP_001295554.1.75428 WP_001295554.1.75491 WP_001295554.1.75515 WP_001295554.1.75612 WP_001295554.1.75672 WP_001295554.1.75679 WP_001295554.1.75687 WP_001295554.1.75735 WP_001295554.1.75853 WP_001295554.1.75983 WP_001295554.1.75995 WP_001295554.1.76039 WP_001295554.1.76196 WP_001295554.1.76211 WP_001295554.1.76312 WP_001295554.1.76361 WP_001295554.1.76376 WP_001295554.1.76446 WP_001295554.1.76547 WP_001295554.1.76562 WP_001295554.1.76707 WP_001295554.1.76712 WP_001295554.1.76815 WP_001295554.1.76909 WP_001295554.1.76948 WP_001295554.1.77175 WP_001295554.1.77214 WP_001295554.1.77291 WP_001295554.1.77358 WP_001295554.1.77470 WP_001295554.1.77471 WP_001295554.1.77595 WP_001295554.1.77636 WP_001295554.1.77648 WP_001295554.1.78000 WP_001295554.1.78007 WP_001295554.1.7808 WP_001295554.1.78089 WP_001295554.1.78196 WP_001295554.1.78321 WP_001295554.1.78413 WP_001295554.1.7847 WP_001295554.1.78583 WP_001295554.1.78610 WP_001295554.1.78612 WP_001295554.1.78750 WP_001295554.1.78791 WP_001295554.1.78953 WP_001295554.1.7896 WP_001295554.1.79004 WP_001295554.1.79086 WP_001295554.1.79246 WP_001295554.1.79306 WP_001295554.1.79312 WP_001295554.1.79478 WP_001295554.1.79525 WP_001295554.1.79558 WP_001295554.1.79685 WP_001295554.1.79764 WP_001295554.1.7985 WP_001295554.1.7987 WP_001295554.1.79871 WP_001295554.1.79931 WP_001295554.1.79984 WP_001295554.1.80060 WP_001295554.1.80136 WP_001295554.1.80320 WP_001295554.1.80428 WP_001295554.1.80440 WP_001295554.1.80444 WP_001295554.1.80517 WP_001295554.1.80524 WP_001295554.1.8057 WP_001295554.1.80612 WP_001295554.1.80626 WP_001295554.1.80662 WP_001295554.1.80666 WP_001295554.1.80804 WP_001295554.1.80805 WP_001295554.1.80884 WP_001295554.1.8090 WP_001295554.1.81034 WP_001295554.1.81054 WP_001295554.1.81286 WP_001295554.1.81313 WP_001295554.1.81576 WP_001295554.1.81577 WP_001295554.1.81589 WP_001295554.1.81618 WP_001295554.1.81715 WP_001295554.1.8172 WP_001295554.1.81723 WP_001295554.1.81806 WP_001295554.1.81832 WP_001295554.1.81935 WP_001295554.1.82275 WP_001295554.1.8235 WP_001295554.1.82439 WP_001295554.1.82485 WP_001295554.1.82647 WP_001295554.1.82691 WP_001295554.1.82700 WP_001295554.1.82715 WP_001295554.1.82754 WP_001295554.1.82831 WP_001295554.1.82853 WP_001295554.1.83020 WP_001295554.1.8308 WP_001295554.1.83097 WP_001295554.1.831 WP_001295554.1.83140 WP_001295554.1.83144 WP_001295554.1.83205 WP_001295554.1.83224 WP_001295554.1.83415 WP_001295554.1.8345 WP_001295554.1.83537 WP_001295554.1.83735 WP_001295554.1.83781 WP_001295554.1.83941 WP_001295554.1.8411 WP_001295554.1.84210 WP_001295554.1.84298 WP_001295554.1.84331 WP_001295554.1.84339 WP_001295554.1.84405 WP_001295554.1.84410 WP_001295554.1.8444 WP_001295554.1.84467 WP_001295554.1.84534 WP_001295554.1.84584 WP_001295554.1.84738 WP_001295554.1.84740 WP_001295554.1.84875 WP_001295554.1.84877 WP_001295554.1.84977 WP_001295554.1.84989 WP_001295554.1.84994 WP_001295554.1.85002 WP_001295554.1.85216 WP_001295554.1.85247 WP_001295554.1.85255 WP_001295554.1.85310 WP_001295554.1.85500 WP_001295554.1.85621 WP_001295554.1.85773 WP_001295554.1.85806 WP_001295554.1.85857 WP_001295554.1.8592 WP_001295554.1.85939 WP_001295554.1.85948 WP_001295554.1.86001 WP_001295554.1.86016 WP_001295554.1.86110 WP_001295554.1.86161 WP_001295554.1.8621 WP_001295554.1.86228 WP_001295554.1.86411 WP_001295554.1.86412 WP_001295554.1.86452 WP_001295554.1.86461 WP_001295554.1.86475 WP_001295554.1.86609 WP_001295554.1.86691 WP_001295554.1.86760 WP_001295554.1.86787 WP_001295554.1.86848 WP_001295554.1.86959 WP_001295554.1.86997 WP_001295554.1.87199 WP_001295554.1.87389 WP_001295554.1.87563 WP_001295554.1.87574 WP_001295554.1.87655 WP_001295554.1.87721 WP_001295554.1.87914 WP_001295554.1.87919 WP_001295554.1.88017 WP_001295554.1.88110 WP_001295554.1.88238 WP_001295554.1.88301 WP_001295554.1.88304 WP_001295554.1.88434 WP_001295554.1.88607 WP_001295554.1.88667 WP_001295554.1.88710 WP_001295554.1.88711 WP_001295554.1.88757 WP_001295554.1.8879 WP_001295554.1.88834 WP_001295554.1.88997 WP_001295554.1.89099 WP_001295554.1.89416 WP_001295554.1.89458 WP_001295554.1.89468 WP_001295554.1.89679 WP_001295554.1.89899 WP_001295554.1.89923 WP_001295554.1.89927 WP_001295554.1.89977 WP_001295554.1.90017 WP_001295554.1.90078 WP_001295554.1.90266 WP_001295554.1.90270 WP_001295554.1.90358 WP_001295554.1.9036 WP_001295554.1.90511 WP_001295554.1.90520 WP_001295554.1.90536 WP_001295554.1.90799 WP_001295554.1.9081 WP_001295554.1.90813 WP_001295554.1.90828 WP_001295554.1.90924 WP_001295554.1.90951 WP_001295554.1.91 WP_001295554.1.91018 WP_001295554.1.91268 WP_001295554.1.91277 WP_001295554.1.91340 WP_001295554.1.91341 WP_001295554.1.91462 WP_001295554.1.91551 WP_001295554.1.91640 WP_001295554.1.9169 WP_001295554.1.91739 WP_001295554.1.91782 WP_001295554.1.91850 WP_001295554.1.91994 WP_001295554.1.9215 WP_001295554.1.92161 WP_001295554.1.92180 WP_001295554.1.92323 WP_001295554.1.92361 WP_001295554.1.92496 WP_001295554.1.92568 WP_001295554.1.92615 WP_001295554.1.9264 WP_001295554.1.92708 WP_001295554.1.92742 WP_001295554.1.92792 WP_001295554.1.92845 WP_001295554.1.92865 WP_001295554.1.92943 WP_001295554.1.92989 WP_001295554.1.93019 WP_001295554.1.93048 WP_001295554.1.93054 WP_001295554.1.93276 WP_001295554.1.93309 WP_001295554.1.93312 WP_001295554.1.93621 WP_001295554.1.93629 WP_001295554.1.93652 WP_001295554.1.93755 WP_001295554.1.93971 WP_001295554.1.94025 WP_001295554.1.94057 WP_001295554.1.94176 WP_001295554.1.94187 WP_001295554.1.94388 WP_001295554.1.94445 WP_001295554.1.94542 WP_001295554.1.9457 WP_001295554.1.94626 WP_001295554.1.94738 WP_001295554.1.94764 WP_001295554.1.948 WP_001295554.1.9489 WP_001295554.1.94898 WP_001295554.1.94949 WP_001295554.1.94993 WP_001295554.1.95037 WP_001295554.1.95332 WP_001295554.1.95395 WP_001295554.1.95518 WP_001295554.1.95595 WP_001295554.1.95827 WP_001295554.1.95849 WP_001295554.1.95919 WP_001295554.1.95932 WP_001295554.1.96015 WP_001295554.1.96215 WP_001295554.1.96279 WP_001295554.1.96281 WP_001295554.1.96299 WP_001295554.1.96303 WP_001295554.1.96339 WP_001295554.1.96417 WP_001295554.1.96479 WP_001295554.1.96659 WP_001295554.1.96936 WP_001295554.1.96984 WP_001295554.1.97011 WP_001295554.1.97119 WP_001295554.1.97123 WP_001295554.1.97231 WP_001295554.1.97418 WP_001295554.1.97439 WP_001295554.1.9747 WP_001295554.1.97560 WP_001295554.1.97667 WP_001295554.1.97677 WP_001295554.1.97685 WP_001295554.1.97825 WP_001295554.1.97930 WP_001295554.1.97982 WP_001295554.1.97996 WP_001295554.1.98012 WP_001295554.1.98220 WP_001295554.1.98241 WP_001295554.1.98294 WP_001295554.1.98355 WP_001295554.1.98424 WP_001295554.1.98442 WP_001295554.1.98477 WP_001295554.1.98578 WP_001295554.1.98614 WP_001295554.1.98628 WP_001295554.1.98776 WP_001295554.1.99265 WP_001295554.1.99310 WP_001295554.1.99319 WP_001295554.1.99361 WP_001295554.1.99392 WP_001295554.1.99400 WP_001295554.1.99534 WP_001295554.1.99602 WP_001295554.1.99632 gi|253772000|ref|YP_003034831.1| gi|145698316|ref|NP_417633.4| gi|386615952|ref|YP_006135618.1| gi|238902268|ref|YP_002928064.1| gi|387622828|ref|YP_006130456.1| 331112.EcHS_A3356 469008.ECBD_0576 511145.b3164 595496.BWG_2868 gi|387823500|ref|YP_003000740.2| gi|387622828|ref|YP_006130456.1| gi|157162649|ref|YP_001459967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]