SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_0782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_0782
Domain Number 1 Region: 7-145
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.62e-33
Family HSP20 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_0782
Sequence length 146
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MSGIHFGNDLFDEFARVQRQMASLLGERPSGIRAGRAGAFPALNVGATDDAIEIVAFAPG
MAAADFDVSIDKDLLTISGERKPAPRTEGDDVRTYAQERFHGAFRRVVELPRDADPDQVS
ARYENGCLLIRVGRREASKPRAITIQ
Download sequence
Identical sequences A0A0H2XP09 A0A1U9MPU0 B1JZ10
gi|116689285|ref|YP_834908.1| 2005334907 WP_011545059.1.101155 WP_011545059.1.21535 WP_011545059.1.24953 WP_011545059.1.27194 WP_011545059.1.43430 WP_011545059.1.4378 WP_011545059.1.50701 WP_011545059.1.88043 WP_011545059.1.90247 WP_011545059.1.90614 WP_011545059.1.95150 WP_011545059.1.96618 WP_011545059.1.9804 WP_011545059.1.98478 WP_011545059.1.98955 331271.Bcen_0782 331272.Bcen2424_1263 406425.Bcenmc03_1235 2005212194 2005212195 gi|170732585|ref|YP_001764532.1| gi|107022338|ref|YP_620665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]