SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_6246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_6246
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily L28p-like 3.26e-22
Family Ribosomal protein L31p 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_6246
Sequence length 88
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEHEGKTYPLAKIEVSSESHSFYTGQ
QKIMDTAGRVEKFKNKFGARANGKAAAK
Download sequence
Identical sequences A0A095GFB8 A0A103AX30 A0A104CHC1 A0A1B4DI17 A0A1U9MRH3 A0K7V7 B1JTB3 Q1BGZ5 V5A2T9
2005334518 gi|116689854|ref|YP_835477.1| 331271.Bcen_6246 331272.Bcen2424_1833 406425.Bcenmc03_1857 gi|170733193|ref|YP_001765140.1| WP_011549676.1.101155 WP_011549676.1.16354 WP_011549676.1.21535 WP_011549676.1.22273 WP_011549676.1.22838 WP_011549676.1.24953 WP_011549676.1.27194 WP_011549676.1.29304 WP_011549676.1.3256 WP_011549676.1.34550 WP_011549676.1.35154 WP_011549676.1.38713 WP_011549676.1.40221 WP_011549676.1.43430 WP_011549676.1.4378 WP_011549676.1.44577 WP_011549676.1.48555 WP_011549676.1.50701 WP_011549676.1.50902 WP_011549676.1.5101 WP_011549676.1.5376 WP_011549676.1.55843 WP_011549676.1.5924 WP_011549676.1.64260 WP_011549676.1.78666 WP_011549676.1.85218 WP_011549676.1.88043 WP_011549676.1.90247 WP_011549676.1.90614 WP_011549676.1.90674 WP_011549676.1.95150 WP_011549676.1.96618 WP_011549676.1.9804 WP_011549676.1.98478 WP_011549676.1.98955 gi|107028988|ref|YP_626083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]