SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_6419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_6419
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.19e-33
Family HSP20 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_6419
Sequence length 147
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MSDIFFPTDLLAEFDRLQRQMASAFTGFPASLRAPRPGTFPPLNIGSTDDTIEIVAFAPG
LDPAKIDISVDRRLLTISGERTPPDDGATDDERRIYANERFMGTFRRVVELPQHADPDKI
EARYANGCLTISVGKSEASKPRAITVQ
Download sequence
Identical sequences A0A0H2Y420 A0A1U9N3F7
gi|116687029|ref|YP_840276.1| gi|107029158|ref|YP_626253.1| WP_011549814.1.27194 WP_011549814.1.43430 WP_011549814.1.5376 WP_011549814.1.96618 331271.Bcen_6419 331272.Bcen2424_6654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]