SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331272.Bcen2424_0419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331272.Bcen2424_0419
Domain Number 1 Region: 11-86
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331272.Bcen2424_0419
Sequence length 91
Comment (Burkholderia cenocepacia HI2424)
Sequence
MSGFEAGSSLTVASAKSALADGLARIGAGATAVDCAALTQFDSSALAVLLAWQRAAQARG
AALDILNLPPKLASLARAYGVDALIEGTGRH
Download sequence
Identical sequences A0A0H2XSF9 A0A1U9MMS7 A0A228HZG0
gi|116688443|ref|YP_834066.1| WP_011546610.1.24344 WP_011546610.1.27194 WP_011546610.1.43430 WP_011546610.1.96618 gi|107024232|ref|YP_622559.1| 331271.Bcen_2688 331272.Bcen2424_0419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]