SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331272.Bcen2424_3489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331272.Bcen2424_3489
Domain Number 1 Region: 8-77
Classification Level Classification E-value
Superfamily ACP-like 0.000000000209
Family Peptidyl carrier domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331272.Bcen2424_3489
Sequence length 85
Comment (Burkholderia cenocepacia HI2424)
Sequence
MSNRNDITDIEAWLVEACGALGLRVENADSDFFAAGGTSITAVKLLSRVEERFGEDALTP
EALFEQSRLSDIASHIAQHSETRTS
Download sequence
Identical sequences WP_011694533.1.101155 WP_011694533.1.21535 WP_011694533.1.24953 WP_011694533.1.4378 WP_011694533.1.50701 WP_011694533.1.5376 WP_011694533.1.88043 WP_011694533.1.90674 WP_011694533.1.95150 WP_011694533.1.96618 WP_011694533.1.9804 WP_011694533.1.98478 WP_011694533.1.98955 gi|116691588|ref|YP_837121.1| 331272.Bcen2424_3489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]