SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_0552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331678.Cphamn1_0552
Domain Number 1 Region: 309-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-48
Family Ribonuclease PH domain 1-like 0.0000094
Further Details:      
 
Domain Number 2 Region: 11-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-44
Family Ribonuclease PH domain 1-like 0.0000636
Further Details:      
 
Domain Number 3 Region: 468-564
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.07e-26
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 4 Region: 138-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.07e-25
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 573-657
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.74e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 6 Region: 637-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000224
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_0552
Sequence length 734
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MFIRKEIDLGDGKVITIETGKMAKQADGATIVRMGDTMVIATVVSSRTPPSPNQDFFPMQ
VEYREKYYAAGKFPGGFIKRESRPSEKEILSARLIDRALRPLFPNGYYQDTQIIISVISS
DQLNDADVLGGIAASAAIMVSDIPFANSMSEVRVGRINGEFVINPTINELAQSDIDISIG
GTNDTICMLEGEMNEISEAEMLEAIRFGHEAIKKICSLQDDIAAEVNKPKRSFLAIDAPD
ELKESIKEACEAPLKELAYMPLAKEERAEKTTAVYKSITEQILGRYKNEITAEDIAADPS
KALYLNEQIISGHIHAIEKQVMRHMILDDAKRLDGRKLEEVRPISIELGLIPRAHGSALF
TRGETQALVVLTLGTKKDAQMIDTLLDDTEKRFMLHYNFPPFSVGETGRVGGVGRREIGH
GNLAERAVKKVVPSESEFPYTIRLVSEILESNGSSSMASVCGATLAAMDGGVPLTKPVSG
IAMGLIKEDDNYAVLSDILGNEDHLGDMDFKVAGTRDGITACQMDIKIDGLDYHILEKAL
EQSKNGRLHILDKMTESIADPRGEIGQYAPKLSTIQVPVDAIGMIIGKGGETIRSITEET
GAQINVDDDGTVTISSPNGESAAAAIETIKTLISKPEVGTIYMGKVKDIREDLGAFVEIL
PRTDGLVHISEIARERVNKVSDHLKQGDRVKVKLIDIRKDQRSGKIRYALSIKALLDMPA
ESANGPSAQEEQNQ
Download sequence
Identical sequences B3EMN6
WP_012474005.1.36401 331678.Cphamn1_0552 gi|189499525|ref|YP_001958995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]