SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_2391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  331678.Cphamn1_2391
Domain Number - Region: 31-63
Classification Level Classification E-value
Superfamily POZ domain 0.0141
Family Tetramerization domain of potassium channels 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_2391
Sequence length 97
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MSTSPYSKFDDANLILRDELAIDRTVLANERTLLSYLRSGVALIIAGVSIMHFSNEGWFW
FVGMSCIPVGFITSIVGAMRYRRMSRSICVVRRECGK
Download sequence
Identical sequences B3EPP9
gi|189501300|ref|YP_001960770.1| WP_012475751.1.36401 331678.Cphamn1_2391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]