SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_AAL177W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_AAL177W
Domain Number 1 Region: 920-1016
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 625-699
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 777-882
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000455
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 4 Region: 156-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 5 Region: 1139-1197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 698-765
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000129
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_AAL177W
Sequence length 1198
Comment (Eremothecium gossypii)
Sequence
MESQAAVEEPQHSVVIETPPTTAESSETPVADTATGAEPEGAGGAAVVAPKRMPTRADFP
PLSSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSGAKPMRSKTMQEAFSLDLQTQVT
ISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVI
QVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADLDDQLINISLHGDVAS
VNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAFPNGSEKIVLM
GPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKVSVIFPTALGD
DTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYDILKDI
KESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLTPSHVLAVD
DLDYELFHKDIKQALSKAEIPFVQLGDHYEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKV
AAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSE
DEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFD
VQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGS
QGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVP
VEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKA
VDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTN
KVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFN
VRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLI
NKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDN
IPWRLTYEHVDLSDILGEEGKHAMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKK
FNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGTKESVEKACKMICDALNK
Download sequence
Identical sequences Q75FA8
33169.AGOS_AAL177W tr|Q75FA8|Q75FA8_ASHGO NP_982365.1.49492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]