SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_AAR024W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_AAR024W
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.31e-37
Family Calponin-homology domain, CH-domain 0.000035
Further Details:      
 
Domain Number 2 Region: 211-284
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000366
Family EB1 dimerisation domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_AAR024W
Sequence length 322
Comment (Eremothecium gossypii)
Sequence
MSGMGESRTELLGWLNDLLRLDYTKVEQCGTGAAYCQIMDSIYGDLPMHRVKFDARAEYE
SLTNFKILQSCFTKHKIEKTVFVDRLIKCRFQDNLEFLQWMRRFWIQNKDESPYDPESRR
KSVRPVSMRAPAQAPPSHAPKRRSLATFAATGTAAAPRPLQKARAAAGGAGGAVATRVPS
GGAPARGTATAGAGEQVAALQGELSAAEHKINKLTQEMVQYQDAMSLMERERDFYFGKLR
DIEILVQSTQDLFKEGVYNDDPQELNRLLGKVSQILYSTEEGFEVANGADGNEEYDVEAG
TRMENCVEGQVLHNLITDDETF
Download sequence
Identical sequences Q75EQ5
tr|Q75EQ5|Q75EQ5_ASHGO 33169.AGOS_AAR024W NP_982565.1.49492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]