SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_ABL173C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_ABL173C
Domain Number 1 Region: 212-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_ABL173C
Sequence length 302
Comment (Eremothecium gossypii)
Sequence
MTNKRRAPLEDISNAIIGQVLETKDARIGRGNGEDFSVDRPQVTAAALDGLFLDGRQLRI
GGGQARSIGGWVRLRVARWSLRKALNTGHVLAAERGQAALIARAHDSQTVELSGRSLDCT
TLSLLRVVGQVAVTVTPALLTQLRCRQLKLRSAIRAWQDTVLLPTHDSEALLADLRIIVS
SGVYPASGPMLIHSCPPLPTPVAPLHAALALPTITQELELNKPQVSFLIGENGSRIEYIK
VASSAIVKVLPIKNKLQNSELKNPSCVRQSLAITGDLCAVARALTSIQAFLDLYHANAKH
KF
Download sequence
Identical sequences Q75E43
tr|Q75E43|Q75E43_ASHGO NP_982774.1.49492 33169.AGOS_ABL173C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]