SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_ADL395C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_ADL395C
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily eIF1-like 5.62e-34
Family eIF1-like 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_ADL395C
Sequence length 108
Comment (Eremothecium gossypii)
Sequence
MSIENLKSFDPFADTGDDEASSSNYIHIRIQQRNGRKTLTTVQGIPEEYDLKRILKVLRK
DFGCNGNMVKDDEMGEIIQLQGDQRAKVCEFLITQLAIPKKNIKIHGF
Download sequence
Identical sequences A0A109UZD5 D8FGF0 G8JML2 Q755R1 R9XG64
NP_983701.1.49492 NP_985312.1.49492 NP_986189.2.49492 XP_002999503.1.49492 XP_003644081.1.63417 XP_003644184.1.63417 XP_017986458.1.1318 XP_017986568.1.1318 XP_017987172.1.1318 XP_017987934.1.1318 sp|Q755R1|SUI1_ASHGO 33169.AGOS_ADL395C 33169.AGOS_AER457W 33169.AGOS_AFR642C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]