SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_AER186C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_AER186C
Domain Number 1 Region: 231-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 26-99
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 136-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_AER186C
Sequence length 316
Comment (Eremothecium gossypii)
Sequence
MTMTDSSSPAPEGPAAPAEAAAPAKVDAQAPLVTLRLLLSLKEAARILGRGGNTIDNIRK
ANGVKIGISTKEKSCSDRLLEVTGSIDAVANSLADVVKVLTADDTNEEDAEPEPEQHIFK
HLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSSIIGTAGSKIKKLIDTHSSKLVVS
KTFLPDSQDRILEIQGFPNSIANCIKDISQTLIKDDVLDTKEKRYYPHSKHSKDIHVTAT
VAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPNQNNEREFTITGNDQKSVKLAQNM
IMKNLGTEKERRLEKQ
Download sequence
Identical sequences Q756R8
NP_985043.1.49492 33169.AGOS_AER186C tr|Q756R8|Q756R8_ASHGO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]