SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_AGR393W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_AGR393W
Domain Number 1 Region: 73-138
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000000107
Family Chaperone J-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_AGR393W
Sequence length 142
Comment (Eremothecium gossypii)
Sequence
MVLPVIAAASITAIAVALRAGVRAWQTYKQLTPLMIAQLNGLRIQAGDVSKFGSKYRTQL
PRSVIAQLEQYPGGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGG
SPYVAMKINEARDVMEQSSLVR
Download sequence
Identical sequences Q74Z14
33169.AGOS_AGR393W NP_987059.1.49492 tr|Q74Z14|Q74Z14_ASHGO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]