SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00000171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00000171
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily POZ domain 4.45e-32
Family BTB/POZ domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00000171
Sequence length 102
Comment (Aspergillus terreus)
Sequence
MSPPTPSEFVTLVSGDGFEFVLPRSTACVSGTIRRMLDPSSKFAEALTGRCVLENISGVV
LEKVCEYFCYNEKNKDQTNVPDMDIPPELCLELLMAADYLDT
Download sequence
Identical sequences Q0CVC0
XP_001211542.1.65242 33178.CADATEAP00000171 ATET_02364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]