SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00000576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  33178.CADATEAP00000576
Domain Number - Region: 127-155
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0915
Family Ribosomal protein L29 (L29p) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00000576
Sequence length 214
Comment (Aspergillus terreus)
Sequence
MHRHSVLRLARQAGGLPLVELPPPYLAPSLHFSLIRSPVQSSNFSSTTPVAGHGRDLSKS
RGVSAIHRTGPKFKLGVSKYPLPKPVSPEALEKRNPTPDHGLWGFFPKDRQALSTPEYDH
AHGRSWSIQELREKSWEDLHALWWVCVKERNRIATSNLERERLKAGYGEYESSERDRVIR
VTQNGIKHVLRERWYAWEDAQKLYKDGYRPQDEE
Download sequence
Identical sequences Q0CXX1
33178.CADATEAP00000576 XP_001208828.1.65242 ATET_01463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]