SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00000862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00000862
Domain Number 1 Region: 76-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.3e-20
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 170-274
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000721
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00000862
Sequence length 277
Comment (Aspergillus terreus)
Sequence
MSSPLILLPGDHVPSEYLPSSNSSAPLRLGPGLRLLSQPPSSTSKSSDHVLAATQPGILT
TDPKRNAVSLLPTPNRRYVPIANDLVIAQIHHSSPDYFHCMITPQAPQVLLGQLAFEGAT
KKTRPMLRQGDLVYARVLSTGLGAGAEVELTCVNPATGRAEPGGLGPLTGGMVFDISTGM
AARLMRASSSSAENQEGVDGLVVLDELGKKLEKVGGFEIAVGRNGKVWVDCANGGDSAIK
ATVAIGRCLSTIDEHNLNPADQKKLVTRILREMKVDG
Download sequence
Identical sequences Q0CH91
33178.CADATEAP00000862 ATET_06951 XP_001209637.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]