SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00001054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00001054
Domain Number 1 Region: 1035-1117
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 887-991
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000331
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 3 Region: 200-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 4 Region: 1238-1300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000134
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 5 Region: 716-789
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 308-413
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 7 Region: 783-879
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 8 Region: 397-466
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00001054
Sequence length 1308
Comment (Aspergillus terreus)
Sequence
MASEVSNSNGIPKSRAAMLEEQHARDEAHKATVEEVPDEEELKHASASTGLEQPSATLSQ
MSTPAETPAPSAPKPAPKKGPAFDVQSEELFPALGSGPKPKVPTASAWGAKGTSGAAAVA
NGAPGGAQSVAGGFGSDVPRIMSLPGKHMEQLRLAPSQMLPRGQLKKPLRDILRDISRRS
KATVDMRGGPGGSIIFEGKGSVDAVRQALKEVAQQVGSKQSVRVPIPTSARPHIIGRQGA
VVQDIQQRTGARVQVPRVDDSAAGQDDDDSDTIDVFIEGDAVAAEMARREIEAIVKERAS
NMSLRLKTIPPEFFPFIAGAHNENLKGIEERTKAQIHVPRYDTWLSQPPPQEADPGHVQF
VPIPERHIHISGERTAAQEARAEIERLAADLQRQLTLRQLAINRGQHQFILGDNDDALHE
FLADTGCAIVLPPPSDDSEFLTITGPLDRIESGINRAMDLATSMQMASIDLSRQHPNAPS
GAHAHARALTRYLTQRQIIKDLERAYDARIALPPSVDGPVTWEVYSRDGKNTIRARSDIM
NLVQAHPPARLLHVSVDPYFHPYLRSRSISKLRNDYGVHLLVPENLEDSNVVLVYEGPSA
TTPEFQVSRQRPSPAEIATFEKVLKEAQDYLLSALGDQTDVVAKSVNIPAKYQEKARKFI
AREQQAKGDDHIPVRAIVGDPRGRPGECEVSLRGPSGLVAELIAKLQSFVVEQEKDDLER
GYTTSFDFPQKYANFLIGRRGENINKLRDEFDVDIKVENGKVEVKGPKAKADAAKVRIIN
LGKKLEDETTHVLKVPAQYHRELIGQKGSQVNRLQDRYAVRVQFPRAAAIADDQSVDNSS
EAGGSRPARGQQGADEVIVKGPSKGADAARDEILSLLQWVIDHSYSATVSVAQSQIPSLI
GQRGREMDKLRADTGAQIDVPSANDAPDASGRVEIKIKGTKKEVEEAKKILQQRSKEFDS
IVTKTIDVDKKHHKSLIGGGGANIRKIVADAGGPTDGSASRLVKFPRPDSAESTIKLEGN
GQIVDKIIAAIEAFVKEREDQVTVNLEVPPTQHRLLIGRGGDTRRGIETQFNVTLDIPKQ
GSGRSDVKLKGPSNAVEEAKQHILSMLKDQQGETIEVPRHLHHVISDNGSFFRRLRNDYQ
VTVDHAGQQAPPKPVADDSRGAVNGASSLPLITDEPSEAVEAHSWKVVDNTPAAADPSQP
ATIPWVLAGTSDNVAKAKAALEKAIASASQQSATGYLILPDPKTYRFVVGQGGSQINSIR
KQTGCRINVPKDQAKGEAIEIKGSKENLDAARDLILEAVRAGLEGNSR
Download sequence
Identical sequences Q0CJV0
33178.CADATEAP00001054 ATET_06034 XP_001215212.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]