SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00001471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00001471
Domain Number 1 Region: 124-627
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-162
Family Calponin-homology domain, CH-domain 0.00000000000137
Further Details:      
 
Domain Number 2 Region: 8-90,151-168
Classification Level Classification E-value
Superfamily EF-hand 0.00000000403
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00001471
Sequence length 645
Comment (Aspergillus terreus)
Sequence
MNVLKLQRKFPQLDQGEIFSLQDAFRKLDVDEKGYLDEATVIKATQQSERQPYDVVRQTL
KEVDLDSSRRVELEDYVDVSSSGTPSAAPVLPGNGAGASRHVSKGSIGGRIHVQGSSANV
THTINEDERTEFTRHINAVLAGDPDIGHILPFPTDTFEMFDQCKDGLVLAKLINDSVPDT
IDERVLNKPGKKIKELNAFHMTENNNIVINSAKGIGCSVVNIGSGDIIEVREHLILGLIW
QIIRRGLLGKIDIKLHPELYRLLEEDETLEQFLRLPPEQILLRWFNYHLKNAKWHRQVTN
FSSDVKDGENYTVLLSQLAPELCSRAPLQTRDLHQRAEEVLVNADKVGCRKFLTPSSLVA
GNPKLNLAFVANLFNTIPGLDPITEEEKLEVEDFDAEGEREARVFTLWLNSLDVQPAVNS
LFDDLRDGTILLQAYDKVIPGSVNWRHVNKPPASGGEMMRFKAVENTNYTIELGKHIGFS
LVGVQGADITDGQRTLTLGLVWQLMRRDITNTLSSLAQRMGKREITDAEMIKWANDMSRK
GGRTSSIRSFKDQSIGSGLFLLDVLNGMKSSYVDYELVTPGRTDEEAYANAKLSISIARK
LGATIWLVPEDICQVRSRLVTTFIGEFPGYTQYFFTGPHILTPVF
Download sequence
Identical sequences Q0CHI3
33178.CADATEAP00001471 XP_001209536.1.65242 ATET_06851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]