SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00002653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00002653
Domain Number 1 Region: 267-363
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Domain Number 2 Region: 570-616
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 3 Region: 641-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000862
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  33178.CADATEAP00002653
Domain Number - Region: 502-560
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00002653
Sequence length 994
Comment (Aspergillus terreus)
Sequence
MHKISNFTGQARHGWERMTPTFGMSRPHTDMASHSLRRPHGAPPMTPPTGLDPVVNLSFN
VPFSSTLAGPDVDDVLHASPGALQRWSFPEGTPEGAPVHSLPVHASNVDALRRLCRQITE
SSSGRIEAVVTSSEPKTVPSLQRRPQGLVTNVCITGEGDTVRKMRAKVLNETPILLRCAT
VDVDIHLIMDGSTKGIRASVLEHLDTLAAYTGTDIFLLSPKLRDTDSAVVSSYGYASDNG
LDQRFRVSIYGDMESAEHAKTRVLIMIDQILKRHVDAMKLDLTMHTLVCGRTRKNIKLIE
AATGTAIYFPPPFPRIFGYTPPGAHRRSEDEVYITGDTQEQIARAKQKLRELVMGVKIYV
KDVIVNSNKIDNILLDRLDKVRKVMEMNGSYVLFPQLGSQRGVVRIQGAEVLHVERTVRE
IMALAGQFYSASWWLIMPDPSQGGFRAPSAADVRTMLSDICTNSGAEVSFDNLTFTINGS
DDSVKSAMMVINQIPFVQRSQYQMRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFD
GFNEYNFHIDVCGNQYESTKNGLDLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKK
YSVFVKFSNAMDRGGMGKEDDDIKVDNVICRTPARNAQSLDLVKQEIMDMVEKVDAEYVS
ERVVINRLYHRELLARMSEIDELEKKWNCKIEFPSTELASDVVTISGPEYQVPQAVDALL
GMVPESHELLFQSSAELREFFQSADFRKDLTPPWDVNTDPPTSEGGSVSPTPAPEDRVVL
GYTRNNAGGLKDAIDFLISRLVAHGLDATTVKGAIPRPKSDSFEESLPFFDSKLLQHAPA
PIVTDSPTRPNFSDETSERGSIFERLRKPGSISSFSSFIGRKNHSASPGSFFKHASSNAS
KASLVSMESRDSGYRNPWNDSGVNLPEDDVPVLGSSHSHSSSNGWPARFDTKFPFGTAPG
DMTPKHDPRASFDSGRPSTSNSTSGYPAPIGPPR
Download sequence
Identical sequences Q0CYB1
33178.CADATEAP00002653 ATET_01323 XP_001208688.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]