SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00002895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00002895
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily POZ domain 0.0000000714
Family BTB/POZ domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00002895
Sequence length 175
Comment (Aspergillus terreus)
Sequence
MQSEMPGPQRGTTTSDKPDSVLVKIMDTGEFSDLTFVCNGEEFKGPQGHCVHAVRAAESS
SPGWLPTLLTRAMQESHTGTISMDSFHVQTVKHFVQFMYTGDYDSNDPPDDDRYPGSASF
DSDRFPTHMIDPRNAPQWTAGGESSTMTATASAPSPTAAASFLDHIRANSAEATD
Download sequence
Identical sequences Q0CX99
33178.CADATEAP00002895 XP_001209050.1.65242 ATET_01685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]