SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00004191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00004191
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-79
Family Calponin-homology domain, CH-domain 0.000037
Further Details:      
 
Domain Number 2 Region: 246-369
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 470-604
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000212
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 4 Region: 372-477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000374
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00004191
Sequence length 644
Comment (Aspergillus terreus)
Sequence
MLTVETQWVNVQQKTFTKWLNDKIKVRNLYIEDLVTDLSNGVILIHLLEILGRETLGRYA
KDPRLRVQKFENVNKSLDFIRDRKIQTINIGAEDIVDGNRKIILGLIWTLISRFTITDIN
EEGMTAKEGLLLWCQRKTALYPGVEVRDFSTSWNDGLAFCALLDNHRPDLIDFDALDKKD
HRGNMKLAFDLASNEIGIPDLLDVDDVCDVARPDERSLMTYIAYWFHAFSQLERVENAGR
RVEKFINNMHGAWEMQNSYERRMKELLRLIREQREQWKNSSFEGTYKDAKEQAFQFSQYK
RNQKRQWVAEKSDLAALLGNIKTKLSTYRLRPYDPPAELRLEVCDQEWEFLTRDEHERSQ
LINETIRDIKNALRRSFADKANDFALTLKTLSLAISGLDGEVEDQLAHVKRLNDNLPPLD
AFLDTIAAIDEQCVEANIEENDYTTYTLDELSYELSLVKSSISKKLAFLENQLVARNMTN
LTPIQLEEFESVFRHFDRDASNTLQELEFSAALASLGLVYDEDEMHQVYIETCGPQRLAQ
NAGVSFEQFIQFMVSVTEDQNTAEQVLQSFHEVADGKPYVTEMDLRLSLIPEELIEHLTQ
TMPKHQGPVKSQDRDVPQYDYISFMGKMMADEDSDDASTNGQGQ
Download sequence
Identical sequences Q0CDG2
33178.CADATEAP00004191 ATET_08272 XP_001216893.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]