SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00005390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00005390
Domain Number 1 Region: 263-343
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00069
Further Details:      
 
Domain Number 2 Region: 122-206
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.74e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 36-107
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000317
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00005390
Sequence length 355
Comment (Aspergillus terreus)
Sequence
MDSTEMHDATMVDESMNDANMIDEPEIEVTPKTEEEYAQSMLTLRAIVSSKEAGIIIGKA
GKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGPLHGTARAYALVAKGLLEGAPQMGMGG
IVSNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERIVEVQG
TPEGIEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGSGSTNTNMGNGYGSRPYNRTGN
GADFSDQSGGYSSRRSNSDAGRFPMVAEDGDEIQTQNISIPADMVGCIIGRAGSKITEIR
RSSGARISIAKAPHDETGERMFTIMGSAAANEKALYLLYENLEAEKTRRSQQPPE
Download sequence
Identical sequences Q0C9M2
XP_001218234.1.65242 ATET_09612 33178.CADATEAP00005390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]