SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00010302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00010302
Domain Number 1 Region: 13-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-32
Family Calponin-homology domain, CH-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00010302
Sequence length 637
Comment (Aspergillus terreus)
Sequence
MASVTSLDKDLRSLRLSRYTPQAAAEVRDWIEDVLQEKLPSGDLLEALKDGVALCRLVNL
AVSPGVKYKVSSMPFVQMENISHFLRACQTAPLSLPPHDVFLTVDLYEAKDPAQVLQCLM
AFSRRANALQPSKFRRAIGVQSKTGTLSPNMTGSSGYGARTPTTKPRGLSNVSDTSGRSS
PAKSPTAVSTWSKKTDEYTTAPAWNIHQYGYMGGASQANQGVAFGARRQITTAAPHVPSL
AEKEKRRREEEERQRREQQEAELHRQRQREEEEARARAEEERIWEEETARLREKERREVE
EERKRWDAEQRRWEEEEQQRLREEKEAEERLEKERLRRREINDSRLNGQFLSQYQATQES
AESQESQRIRELERELELAKVREAEYQRERQSLREQKSGSTESRSPRPTPVPPKPSYSLS
SLETERRLLRGEWQKHQDDGPSVESASSPPPPLPSRPLPDPTASAQAPATTSDNLPPTSP
RPLPERPLPDPTLQAQKFQKPESRVDRFLSSNRPPVAPKPATHRPADYSSTAEIDAENNR
RAAAQQKTRAGGWASKSLLEREMERERERQREWEENQKQTQEVAARGLGDKSLGSGPGQA
WDVHQYGFMGGDNQNRGGPGLGVGGARRQIIGPRPPP
Download sequence
Identical sequences Q0CSX7
33178.CADATEAP00010302 ATET_03207 XP_001212385.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]