SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RJ78 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RJ78
Domain Number 1 Region: 79-133
Classification Level Classification E-value
Superfamily POZ domain 0.0000000102
Family BTB/POZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RJ78
Sequence length 177
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSGMLAAQAGNARTNRGETSLGAAMRAPSTTTPDVVVLSFVDEDIKVKEAADPKKDLWVS
SVDGRYSSPMIPVRVGPHAQTFYVHRDILTKSEYFRKALDGGFKEAQDQALDLPEENPTL
FEFVIAFLYESKYSPLRPVAEILVVEPEKGKGREQNEDGNASGSDDGSDSGTASDER
Download sequence
Identical sequences 332648.A6RJ78 BC1T_00499 XP_001561414.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]