SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RJK7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  332648.A6RJK7
Domain Number - Region: 9-35
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000709
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RJK7
Sequence length 52
Comment (Botryotinia fuckeliana B05.10)
Sequence
MRSGGDLEAFTCVYVHLRAFTDGCDVWMHYACLPEKEGEIGKASDHDNGRRP
Download sequence
Identical sequences BC1T_00628 XP_001560600.1.26476 332648.A6RJK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]