SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RKC3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RKC3
Domain Number 1 Region: 365-594
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.85e-83
Family Calponin-homology domain, CH-domain 0.000039
Further Details:      
 
Domain Number 2 Region: 613-736
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-29
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 838-997
Classification Level Classification E-value
Superfamily EF-hand 1.51e-16
Family Calmodulin-like 0.0065
Further Details:      
 
Domain Number 4 Region: 739-844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000528
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RKC3
Sequence length 1026
Comment (Botryotinia fuckeliana B05.10)
Sequence
MFSALKKSLRIEPKIEPPKNDTPSKEAKEEDVLSERIEDIIVIKDLDATRKEGETGKIEE
AGDEDLFVVKDLDARLEEEDIKRDQNPRGEERLEDDKEEAESMEEKYIEEEDTLVVKDLD
VKDEIESLEEKDVRVDETNVEPDVTREKVEENSASELTLPSISSKTIEVPLQPSPPSPPS
SEIGDHVEEIKGKQTPTPLAASAIFDTPGNDRCLVGSPPATTANPNLEVNKIEETSTSTS
PRHSRTISPTPIENHSHTQNQEKRLSSSTTDFEINAPNTPPATPPRVVRRERSASQRERE
TLRSRQFSEAARLQRSAEKPEKGEEELGLGRRRKRYQHRNKSKGSNSGSGEALKAVEPLH
EHQLGKMAFAEQQQWITVQQKTFTKWLNTKIAHRKLEVIDLVKDLSDGVILIHLLECLSN
ESLGRYAAKPKLRVQRFENANLSLDFIKSRGIQMTNIGAEDVVDGNRKIILGLIWTLILR
FTISDINLEGMTAKEGLLLWCQRKTACYEEVDVRNFTDSWNDGLAFCALLDIHRPDLIDY
DTLDKDDHRGNMQLAFDIATKEIGIPALLDVEDVCDVAKPDERSLMTYIAYWFHAFSQME
KVENAGRRVEKFVNNMQGAWEMQSAYEKRMRALLKSIKEQVITWQDATFEGTYADAKKQA
THFSSYKRGQKREWVAEKSDLAALLGNIKTKLSTYRLRAYDPPPELRLSVLDEEWAKLMK
GEMARGQLINETIRDIKNALRRSFADKANDFATTLNTMQLAISGLEGDVEDQLVHVRRLH
DNLPPLNQFLDQIEAIDKKCEEANIEENDFTTYTYDELCYEMSLVKNSVAKKLAFLDNQV
VARNMTNLTPIQLEEFESVFRHFDRDATNSLQELEFSAALASLGLVFSEDEMHDYFLDTS
NGKDYVTFEEFIRFMVDVTEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPDEVIEKL
TQFIPIHKGPDLQEDRGMPQYDYISFMDKLLGGNDEDGNEGALSELTNGRSPKRASGSGG
KANGAH
Download sequence
Identical sequences XP_001560866.1.26476 332648.A6RKC3 BC1T_00894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]