SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RP10 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RP10
Domain Number 1 Region: 368-447
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00036
Further Details:      
 
Domain Number 2 Region: 204-283
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 118-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000125
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RP10
Sequence length 453
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSASPTTAPTQSTKRPLEDPSSPSAPSDQPDAKRPALDKIVKGEDDAEKKPSVIETELPV
LTNPNGDAKPDEANGIKEEVKDAQGDTEVVDAPTTEAAQPIQTTVPAKTEGASSGNALPH
DESGWIHVRSVITSAEAATVIGKGGENVSLVRKLSGAKCTVSDYQKGAVERILTVSGVVD
AVAKAFGLIIRTLNNEPLEAPSDSTSKTYPLRLLIPHILIGSIIGKGGVRIKEIQEASGA
RLNASDSYLPLSTERSLVVLGVADAVHIATYYVGSTLFEQLTERFGGPAASAYASRSGGP
AGVVPGAMPNHTVKDRHLTNSQLPLHITGGHASPAVGGYGGVGPQQPQQAGHAVPQPHGA
TGPQGQPMPGAIPGQPLTQQIFIPNDMVGAIIGKGGAKINEIRQLSGSVIKINEPQDNSN
ERLVTITGTAECNQMALYMLYSRLESERHRASS
Download sequence
Identical sequences XP_001559019.1.26476 332648.A6RP10 BC1T_02183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]