SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RQT5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RQT5
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily Histone-fold 5e-40
Family Nucleosome core histones 0.0000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RQT5
Sequence length 143
Comment (Botryotinia fuckeliana B05.10)
Sequence
MAGGKGKSSGGKSSAGGKVGADGNKKQQSHSSKAGLQFPCGRVKRFLKNNTQNKMRVGAK
AAVYVTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDTLIRATIAFGGV
LPHINRALLLKVEQKKKKTIESA
Download sequence
Identical sequences G2Y0R8 M7TWF6
XP_001558737.1.26476 332648.A6RQT5 BC1T_02808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]