SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RS65 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  332648.A6RS65
Domain Number - Region: 78-164
Classification Level Classification E-value
Superfamily POZ domain 0.00149
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RS65
Sequence length 206
Comment (Botryotinia fuckeliana B05.10)
Sequence
MAMSSIANIVIDPDGDLVLLLNPTTPDSQNFTEMMSALNSTCSTPDTEISRDADARRRAS
LELEVLTSESHMLYDDRILVSSKHMCLASPVFKAVIEGEFPEDVLPIAGKLGLPLPNDDP
PAMKILIHIIHGRMNMVPLNIDLELFTQITILVDKYECHEVVRLLPLIWSYGLSDSFSET
SWTDIARWSHAGLKEYEKLSRFSKIP
Download sequence
Identical sequences BC1T_03092 XP_001558060.1.26476 332648.A6RS65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]