SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6RSL0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RSL0
Domain Number 1 Region: 143-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.04e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 29-87,122-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000141
Family Glutathione S-transferase (GST), N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RSL0
Sequence length 271
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSEQKITHWVALNDKTGEFKRGQSQFRNFIKKGGEFPPEKGRYHLYVSYACPWAHRALIV
RKLKGLEDIIPYTSVHWHMGEKGWKFATPDDDVTGENVTASPVEAHKEFTHLRDIYFQVD
PEYTGRFTDPTLYDFDDIIAPEYKNVDLFPANLQKEIEATNEWTYNDINNGVYRSGFATK
QEAYEKAVIQLFASLDRVEKHLSESEGPYYYGKNITEADVRLFTTIIRFDVVYVQHFKIN
PFSIAPVGPEPPILREDEEVPAVKWALSLRK
Download sequence
Identical sequences BC1T_03433 XP_001557851.1.26476 332648.A6RSL0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]