SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6S762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6S762
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily POZ domain 0.0000000863
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6S762
Sequence length 89
Comment (Botryotinia fuckeliana B05.10)
Sequence
MLVQIFVGAERKKYSAHKNLICKSGDFFRDVFQDNGNGAENKMDLPEDNPYIFDALASWM
YTKHLGGLPSVDEESDIPIIELYIFADKY
Download sequence
Identical sequences XP_001552950.1.26476 BC1T_08637 332648.A6S762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]