SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6S9L4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6S9L4
Domain Number 1 Region: 253-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-41
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 952-1061
Classification Level Classification E-value
Superfamily CAD & PB1 domains 8.69e-21
Family PB1 domain 0.0061
Further Details:      
 
Domain Number 3 Region: 443-608
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000915
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Weak hits

Sequence:  332648.A6S9L4
Domain Number - Region: 143-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.001
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6S9L4
Sequence length 1066
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSSGGVAIRVAQSQSHGPLLRTNTAPVFNNRSAEGNGTGLSQTMSHNSRSSQLTGSTAFT
TSSTTSLNSLSTSATLVPAPLAMPVQGGNVIATNNIINQRADASRSLYQICVNLRQRLAQ
VPGFNGHFVDSDDEDEAEEDMDPVSSLWRCLRKGTPLVTLYNTLQPAEPLPLPDNKMAEP
KKSKMAAFKFVEACMKDLQIPPGDVFALSDLFGDDTTGFVKVTQVINIVLDVAEQRGLLL
TSRAEDTNESATAPGSKMSYRQHVVRELVDTERKYVQDLENLHELKKTIEQKGVIAGDVV
HDIFLNINAILDFQRRFLIKIETTNSQPVDKQEWGLPFRNYEEAFGIYQPFIANQRKAAS
IAKDNFDKITMADHPVVVDFNTLDGFLLKPMQRLVKYPLLLKDLRDKTNASDEAKEDLTL
GIEASNRVLHQANAAVDRELRGEALLDLCGRVDDWKNHRVDHFGDLILHGHFPVVTGKSD
VQKEVHFPLSPRQNSAKTYEPEQYTIYLFERILLCCKEVNPNKSKDKLMGNQKDKKDRKD
KNKIKEKDKNAKLQLKGRIFMTNVTDVVSSAKPGSYTVQIYWKGDPGVENFIIRFSNEET
MKKWYEGVDKQKKEHANIGAQTSTSPDTALRDFEWARDQIASMPNPYAQQEDEDEEEDYS
GTTAYGSPPNFGMPPNFGMPPNASMARNSSNNSLRSRSATTEGSNPSLAGIARAAPPRFP
AGTSMATPLSLQTQMSGSLPSPGQRLGGDSYFSPIGESPAPSARTSTSSTFQFPQTSQFP
RQPTPQGSWEDSNRYTAPATSRVQPRERENGSVSGPSYQMNGRTPQRPSLPAMATSSQAA
AAAAQQRSRSYSTPDINAQQGVRRLPNGALSTPQGQVPAVPGIPAHLHPAYDAGVPRSQN
NSPNGLPVRTNTQSPGVQRERQLQQQQPPHNTTQIPTTALDSRLPPSLMSGNGGMSLSPE
GDTLLPTQLKVKVNCDGNYVTLVVAFNITYQSLTDRIDAKVGRFSTNAIARGTMRLRYRD
EDGDFVTIESDDDIQIAFQEWSEAQKSHTGQLGEIELFCLSIDGER
Download sequence
Identical sequences 332648.A6S9L4 XP_001552053.1.26476 BC1T_09394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]