SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6SBK1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6SBK1
Domain Number 1 Region: 43-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-16
Family Chaperone J-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 332648.A6SBK1
Sequence length 106
Comment (Botryotinia fuckeliana B05.10)
Sequence
MASILTVTAGVAAAAFLGRAGLVAFRKSRGEAVGALGKAFYKGGFEPKMNRREAALILQL
SERQLTKERIRKNHRTLMMLNHPDRGGSPYLATKVNEAKEFLEKNG
Download sequence
Identical sequences G2YGG2 M7UNZ9
BC1T_10252 332648.A6SBK1 XP_001551426.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]