SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6SIB6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6SIB6
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily POZ domain 0.0000000118
Family BTB/POZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 332648.A6SIB6
Sequence length 216
Comment (Botryotinia fuckeliana B05.10)
Sequence
MGIMDNEVFHFEDDDYDYQSSNDEYSDELESEPWENRSRRSTNPEEQVPRATPADQFLSK
INLLTGPTVKIVVNSMNGSKQTLTVPKNLLCTRSSFFHHAFNGTFKESVSQELQLPETSI
AEFELVIQFLSTDTFTFPSTVIDSHEKLTLYLLFFKSCHQFSIIGLSPIIIRFRNFLRWC
SARGEFPDRFHMQIAISLPASHEARKLAVAACVKPL
Download sequence
Identical sequences 332648.A6SIB6 BC1T_12196 XP_001548965.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]