SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 334390.LAF_1507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  334390.LAF_1507
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 4.97e-21
Family Ribosomal protein L29 (L29p) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 334390.LAF_1507
Sequence length 68
Comment (Lactobacillus fermentum IFO 3956)
Sequence
MKTKDYVQELNGLTTEQLLNREKELKEQLFNLRFQLATGQLENTASLKTVRKNIARVKTV
LRQQELNN
Download sequence
Identical sequences A0A0G9GBV7 A0A0N7CJY7 A0A142KT41 B2GDW1 C0WZR4 D0DSY2 D8IIP9 R4RMA7 T0SN87 V4XMP4
WP_003681586.1.10140 WP_003681586.1.25573 WP_003681586.1.34248 WP_003681586.1.36713 WP_003681586.1.38553 WP_003681586.1.47711 WP_003681586.1.49422 WP_003681586.1.49837 WP_003681586.1.55334 WP_003681586.1.56007 WP_003681586.1.58853 WP_003681586.1.58986 WP_003681586.1.66374 WP_003681586.1.74232 WP_003681586.1.74320 WP_003681586.1.77571 WP_003681586.1.81600 WP_003681586.1.81714 WP_003681586.1.82607 WP_003681586.1.82755 WP_003681586.1.86783 WP_003681586.1.88712 WP_003681586.1.9078 WP_003681586.1.93965 WP_003681586.1.94331 WP_003681586.1.99752 WP_003681586.1.99973 gi|501675441|ref|YP_007995834.1| gi|184155983|ref|YP_001844323.1| 334390.LAF_1507 gi|385812633|ref|YP_005849024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]