SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335283.Neut_0083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335283.Neut_0083
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 1.7e-44
Family DR1885-like metal-binding protein 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335283.Neut_0083
Sequence length 164
Comment (Nitrosomonas eutropha C71)
Sequence
MIRAHFRHCVIIALLAATIPTAQAAEPTTVTVHDAWARATPPGIRVGGGYVTVANTGKQA
DRLVGASSPLAEKAEIHISETVDGMARMRHLKDGVKIPAGKEVILAPGGIHLMFLGLKQA
IVKDEVVPVTLQFERAGEIDVQLRAAQIGSLKAPASTEDATHAH
Download sequence
Identical sequences Q0AJV0
335283.Neut_0083 gi|114330114|ref|YP_746336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]