SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335284.Pcryo_0412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335284.Pcryo_0412
Domain Number 1 Region: 46-152
Classification Level Classification E-value
Superfamily HCP-like 7.19e-26
Family HCP-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335284.Pcryo_0412
Sequence length 193
Comment (Psychrobacter cryohalolentis K5)
Sequence
MKLLKAALFTAIFSCAGFANAELISNVPLDTSRFELMPISELSNRAAQGNDHAQFYLAKR
LQKGEGIAQNTKQAVQWYTKAAQQGVAPAQLNLAIMYLRGEGVQPNLQQARGWLEKAAMR
GDNRASYTLALLDEKQKNLVDAYKWYDLAARDGMLDEKVRNKARGKIGQLALNLSSADIA
SARSKADTWFQSK
Download sequence
Identical sequences Q1QDQ8 S4Z0G9
335284.Pcryo_0412 gi|521178637|ref|YP_008162353.1| WP_011512780.1.1051 WP_011512780.1.38006 WP_011512780.1.88559 gi|93005242|ref|YP_579679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]