SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335541.Swol_0064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335541.Swol_0064
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-42
Family GHMP Kinase, N-terminal domain 0.0000422
Further Details:      
 
Domain Number 2 Region: 166-280
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.09e-24
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335541.Swol_0064
Sequence length 285
Comment (Syntrophomonas wolfei Goettingen)
Sequence
MRRNIILKAPAKVNLTLDVKGKRSDGYHELETVMHQVNLLDIIIISQAAGGIQIKSNSSL
IPTNEENLAYQAAEMILGEYAHKEGVEIYIEKNIPVGAGLAGGSTDAAAVILGINQLYDL
GLEEEELLEMAASIGSDVAFCLAGGSKLARGRGEILSKLPQRMIPYIILVKPDFQLSTAE
VYRELDLTQVEEFPDNAAFLAAWEAYDIINIARNMRNVLETVSIRKYPEIAAIKAELIET
GALNALMSGSGPSVMGIFMEEEQALKAREKFQTRYQEVFLLSSYV
Download sequence
Identical sequences Q0B0T2
WP_011639533.1.6463 gi|114565639|ref|YP_752793.1| 335541.Swol_0064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]