SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335541.Swol_1254 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335541.Swol_1254
Domain Number 1 Region: 309-468
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-30
Family HD domain 0.019
Further Details:      
 
Domain Number 2 Region: 203-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000017
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Weak hits

Sequence:  335541.Swol_1254
Domain Number - Region: 31-80
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.017
Family F1F0 ATP synthase subunit B, membrane domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 335541.Swol_1254
Sequence length 515
Comment (Syntrophomonas wolfei Goettingen)
Sequence
MIEIDLTSFVIITLSLAVGLTGGYYGRRFLAESRIRTAEEEVAKMLDEAAKEVEAKKKEI
LLEAKDEIHRNRQDAEKDIRERRRELDRVERRIIQKEEMIDKKTENMEKKEQVLLEKEKE
TEKTQQDLQMVLSQQLKELERLSGLSSEEAKELLLYNVSQQIRQETAVLIRNIENEAKEE
ADKKAKNIVSLAIQKCAADVVSESTVSVVPLPNDEMKGRIIGREGRNIRTFEALSGVDLI
IDDTPEAVILSSFDPIRREVARVALGNLVSDGRIHPARIEEMVEKARKEIEQEIREVGEQ
AAFEVGVHGLHPELIKLLGRLKYRTSYGQNVLRHSVEVAHLAGIMAAELEVDIMLAKRSG
LLHDIGKAVDHEVSGPHVEIGVDLAKKYRENKDVIHGIEAHHGDIEPETVEAVLVQAADA
ISASRPGARRETLETYIKRLEKLENVAESFSGVDRTFAIQAGREIRIIVKPEEIDDLHSI
NLARDIAAKIEQDLDYPGQIKVVVIRETRSVEYAK
Download sequence
Identical sequences Q0AXJ1
gi|114566780|ref|YP_753934.1| 335541.Swol_1254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]