SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335992.SAR11_0412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335992.SAR11_0412
Domain Number 1 Region: 5-232
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 1.57e-32
Family Glycerol-3-phosphate (1)-acyltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335992.SAR11_0412
Sequence length 233
Comment (Candidatus Pelagibacter ubique HTCC1062)
Sequence
MIRNFLFSLFFFLGIVLISIIFLPAILLPKKIVLFGGKIMGFWTSLCLKIFLSTKIIIKG
RENIIRGKKFFIAASHQSMFETFFLQTIFNSPVFILKKELLMIPIFGWYLKKIGSISIKR
NKISKENLGFFDDISKQVKLSERPLIIFPQGTRLSAEDRTPFKKGSGRIYEELNIPCQPI
AINSGNTWPKHGWKKINTTLTVSILKPIEPGLSKEIFTKELEKTIYTELDTLS
Download sequence
Identical sequences Q4FNK6
335992.SAR11_0412 WP_011281690.1.22465 WP_011281690.1.73441 gi|71083117|ref|YP_265836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]