SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 336982.TBFG_12394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336982.TBFG_12394
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-40
Family Tandem AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 2 Region: 18-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000122
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 336982.TBFG_12394
Sequence length 352
Comment (Mycobacterium tuberculosis F11)
Sequence
MTSRETRAADAAGARQADAQVRSSIDVPPDLVVGLLGSADENLRALERTLSADLHVRGNA
VTLCGEPADVALAERVISELIAIVASGQSLTPEVVRHSVAMLVGTGNESPAEVLTLDILS
RRGKTIRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVHALQTKQVTRIILTR
PAVEAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIPKLMSAGVIEVAPLAYMRGR
TLNDAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQIDLPGGARSGLRAAVDILE
DIDDIHIAELTSVDVVRHRLVSEIVDAYARYEEPGSGLNRAARRASGARGRR
Download sequence
Identical sequences A0A045HCE1 A0A083W2S1 A0A0H3LFN9 A0A0H3M8H4 A0A0K2HXZ6 A0A109SPL2 A0A120J1W5 A0A197IXH6 A0A1S1BFG5 A5U561 F8M1F7 G0TP51 I6X417 M8CL31 P0A5S1 P9WIA2 P9WIA3 R4MK25
gi|224990741|ref|YP_002645428.1| gi|494700804|ref|YP_007966286.1| gi|375295817|ref|YP_005100084.1| gi|386005283|ref|YP_005923562.1| gi|385999148|ref|YP_005917447.1| NYSGXRC-T511 gi|392432024|ref|YP_006473068.1| gi|378772098|ref|YP_005171831.1| gi|494696745|ref|YP_007962248.1| gi|31793545|ref|NP_856038.1| gi|471338354|ref|YP_007611067.1| gi|525674950|ref|YP_008226460.1| gi|479056330|ref|YP_007352136.1| gi|479315310|ref|YP_007855362.1| gi|197740962|ref|YP_002162276.1| gi|339632394|ref|YP_004724036.1| gi|148823571|ref|YP_001288325.1| gi|57116978|ref|YP_177874.1| gi|121638247|ref|YP_978471.1| gi|506926893|ref|YP_008007343.1| gi|340627379|ref|YP_004745831.1| gi|385991696|ref|YP_005909994.1| gi|253798554|ref|YP_003031555.1| gi|433627497|ref|YP_007261126.1| gi|15841880|ref|NP_336917.1| gi|57116978|ref|YP_177874.1| gi|506926893|ref|YP_008007343.1| gi|449064429|ref|YP_007431512.1| gi|392387009|ref|YP_005308638.1| gi|433631484|ref|YP_007265112.1| WP_003412235.1.100000 WP_003412235.1.100021 WP_003412235.1.100069 WP_003412235.1.100087 WP_003412235.1.10015 WP_003412235.1.100208 WP_003412235.1.100216 WP_003412235.1.100255 WP_003412235.1.100260 WP_003412235.1.100270 WP_003412235.1.100279 WP_003412235.1.100286 WP_003412235.1.100308 WP_003412235.1.100309 WP_003412235.1.100318 WP_003412235.1.100337 WP_003412235.1.100338 WP_003412235.1.10037 WP_003412235.1.100383 WP_003412235.1.100395 WP_003412235.1.100396 WP_003412235.1.1004 WP_003412235.1.100401 WP_003412235.1.100459 WP_003412235.1.100460 WP_003412235.1.100552 WP_003412235.1.100581 WP_003412235.1.100600 WP_003412235.1.100625 WP_003412235.1.10064 WP_003412235.1.100666 WP_003412235.1.100671 WP_003412235.1.100677 WP_003412235.1.100682 WP_003412235.1.100697 WP_003412235.1.100703 WP_003412235.1.100716 WP_003412235.1.100722 WP_003412235.1.100754 WP_003412235.1.100757 WP_003412235.1.100772 WP_003412235.1.1008 WP_003412235.1.100812 WP_003412235.1.100866 WP_003412235.1.10088 WP_003412235.1.100889 WP_003412235.1.10090 WP_003412235.1.100910 WP_003412235.1.100915 WP_003412235.1.100918 WP_003412235.1.100935 WP_003412235.1.100984 WP_003412235.1.100992 WP_003412235.1.100998 WP_003412235.1.101 WP_003412235.1.101025 WP_003412235.1.10104 WP_003412235.1.101048 WP_003412235.1.101054 WP_003412235.1.101075 WP_003412235.1.101143 WP_003412235.1.101146 WP_003412235.1.10116 WP_003412235.1.10117 WP_003412235.1.101209 WP_003412235.1.10125 WP_003412235.1.101290 WP_003412235.1.101323 WP_003412235.1.101324 WP_003412235.1.101350 WP_003412235.1.101403 WP_003412235.1.101421 WP_003412235.1.10144 WP_003412235.1.101442 WP_003412235.1.10145 WP_003412235.1.101452 WP_003412235.1.101456 WP_003412235.1.101481 WP_003412235.1.101493 WP_003412235.1.101496 WP_003412235.1.101525 WP_003412235.1.101533 WP_003412235.1.101535 WP_003412235.1.101553 WP_003412235.1.101558 WP_003412235.1.10156 WP_003412235.1.101573 WP_003412235.1.101576 WP_003412235.1.10159 WP_003412235.1.101592 WP_003412235.1.101604 WP_003412235.1.101607 WP_003412235.1.101644 WP_003412235.1.101659 WP_003412235.1.101671 WP_003412235.1.101687 WP_003412235.1.101698 WP_003412235.1.10170 WP_003412235.1.101713 WP_003412235.1.101722 WP_003412235.1.101733 WP_003412235.1.101743 WP_003412235.1.101753 WP_003412235.1.101754 WP_003412235.1.101764 WP_003412235.1.101773 WP_003412235.1.101795 WP_003412235.1.101797 WP_003412235.1.101798 WP_003412235.1.101802 WP_003412235.1.101826 WP_003412235.1.101836 WP_003412235.1.101858 WP_003412235.1.101859 WP_003412235.1.101862 WP_003412235.1.101888 WP_003412235.1.101894 WP_003412235.1.101899 WP_003412235.1.1019 WP_003412235.1.101923 WP_003412235.1.101925 WP_003412235.1.10193 WP_003412235.1.101996 WP_003412235.1.102 WP_003412235.1.102008 WP_003412235.1.102017 WP_003412235.1.102053 WP_003412235.1.102055 WP_003412235.1.102063 WP_003412235.1.102099 WP_003412235.1.1021 WP_003412235.1.10211 WP_003412235.1.102119 WP_003412235.1.102121 WP_003412235.1.102143 WP_003412235.1.10216 WP_003412235.1.10224 WP_003412235.1.10253 WP_003412235.1.10262 WP_003412235.1.10272 WP_003412235.1.10277 WP_003412235.1.1033 WP_003412235.1.10350 WP_003412235.1.10362 WP_003412235.1.10366 WP_003412235.1.10376 WP_003412235.1.10396 WP_003412235.1.10410 WP_003412235.1.10414 WP_003412235.1.10430 WP_003412235.1.1044 WP_003412235.1.10440 WP_003412235.1.10445 WP_003412235.1.10471 WP_003412235.1.10472 WP_003412235.1.105 WP_003412235.1.10518 WP_003412235.1.10523 WP_003412235.1.10545 WP_003412235.1.1057 WP_003412235.1.10594 WP_003412235.1.10603 WP_003412235.1.10606 WP_003412235.1.10615 WP_003412235.1.10623 WP_003412235.1.10635 WP_003412235.1.10643 WP_003412235.1.10648 WP_003412235.1.10662 WP_003412235.1.10709 WP_003412235.1.10735 WP_003412235.1.10740 WP_003412235.1.10756 WP_003412235.1.10791 WP_003412235.1.10799 WP_003412235.1.10825 WP_003412235.1.10848 WP_003412235.1.10863 WP_003412235.1.10879 WP_003412235.1.10912 WP_003412235.1.10916 WP_003412235.1.10927 WP_003412235.1.1095 WP_003412235.1.10956 WP_003412235.1.10962 WP_003412235.1.10980 WP_003412235.1.1100 WP_003412235.1.11040 WP_003412235.1.11061 WP_003412235.1.11141 WP_003412235.1.11171 WP_003412235.1.11175 WP_003412235.1.11176 WP_003412235.1.11222 WP_003412235.1.11329 WP_003412235.1.1133 WP_003412235.1.11342 WP_003412235.1.11373 WP_003412235.1.11376 WP_003412235.1.11390 WP_003412235.1.11402 WP_003412235.1.11481 WP_003412235.1.11487 WP_003412235.1.11489 WP_003412235.1.11491 WP_003412235.1.11514 WP_003412235.1.11587 WP_003412235.1.11589 WP_003412235.1.11596 WP_003412235.1.11604 WP_003412235.1.11610 WP_003412235.1.11697 WP_003412235.1.11707 WP_003412235.1.11752 WP_003412235.1.11758 WP_003412235.1.11761 WP_003412235.1.11775 WP_003412235.1.11804 WP_003412235.1.11822 WP_003412235.1.11826 WP_003412235.1.11856 WP_003412235.1.11898 WP_003412235.1.11906 WP_003412235.1.11939 WP_003412235.1.11960 WP_003412235.1.11961 WP_003412235.1.11972 WP_003412235.1.11984 WP_003412235.1.120 WP_003412235.1.12001 WP_003412235.1.12049 WP_003412235.1.12052 WP_003412235.1.12100 WP_003412235.1.12116 WP_003412235.1.12130 WP_003412235.1.12133 WP_003412235.1.12161 WP_003412235.1.12165 WP_003412235.1.12184 WP_003412235.1.12187 WP_003412235.1.12190 WP_003412235.1.12216 WP_003412235.1.12265 WP_003412235.1.12275 WP_003412235.1.12293 WP_003412235.1.12294 WP_003412235.1.123 WP_003412235.1.1231 WP_003412235.1.12314 WP_003412235.1.12327 WP_003412235.1.12338 WP_003412235.1.1236 WP_003412235.1.12371 WP_003412235.1.12372 WP_003412235.1.12389 WP_003412235.1.12406 WP_003412235.1.1241 WP_003412235.1.12421 WP_003412235.1.12424 WP_003412235.1.12446 WP_003412235.1.12464 WP_003412235.1.12479 WP_003412235.1.12519 WP_003412235.1.12523 WP_003412235.1.12526 WP_003412235.1.1255 WP_003412235.1.12550 WP_003412235.1.12551 WP_003412235.1.12563 WP_003412235.1.12669 WP_003412235.1.1267 WP_003412235.1.12672 WP_003412235.1.12692 WP_003412235.1.1271 WP_003412235.1.12710 WP_003412235.1.1279 WP_003412235.1.12794 WP_003412235.1.12801 WP_003412235.1.12804 WP_003412235.1.12821 WP_003412235.1.12841 WP_003412235.1.12854 WP_003412235.1.12871 WP_003412235.1.12901 WP_003412235.1.12941 WP_003412235.1.12947 WP_003412235.1.12957 WP_003412235.1.12972 WP_003412235.1.13028 WP_003412235.1.13043 WP_003412235.1.13086 WP_003412235.1.13087 WP_003412235.1.13090 WP_003412235.1.13096 WP_003412235.1.13163 WP_003412235.1.13175 WP_003412235.1.13183 WP_003412235.1.132 WP_003412235.1.13249 WP_003412235.1.13282 WP_003412235.1.13284 WP_003412235.1.13296 WP_003412235.1.13298 WP_003412235.1.13302 WP_003412235.1.13306 WP_003412235.1.13312 WP_003412235.1.13313 WP_003412235.1.13321 WP_003412235.1.13345 WP_003412235.1.13358 WP_003412235.1.13370 WP_003412235.1.13375 WP_003412235.1.1338 WP_003412235.1.13420 WP_003412235.1.13433 WP_003412235.1.13435 WP_003412235.1.13438 WP_003412235.1.13461 WP_003412235.1.13466 WP_003412235.1.13489 WP_003412235.1.13526 WP_003412235.1.13551 WP_003412235.1.13564 WP_003412235.1.13579 WP_003412235.1.13647 WP_003412235.1.13667 WP_003412235.1.13697 WP_003412235.1.13719 WP_003412235.1.13763 WP_003412235.1.1377 WP_003412235.1.13774 WP_003412235.1.13786 WP_003412235.1.13793 WP_003412235.1.13794 WP_003412235.1.13817 WP_003412235.1.13834 WP_003412235.1.13866 WP_003412235.1.13880 WP_003412235.1.13899 WP_003412235.1.13909 WP_003412235.1.13919 WP_003412235.1.13920 WP_003412235.1.13952 WP_003412235.1.13953 WP_003412235.1.13962 WP_003412235.1.1398 WP_003412235.1.13988 WP_003412235.1.14027 WP_003412235.1.14046 WP_003412235.1.14115 WP_003412235.1.1415 WP_003412235.1.14152 WP_003412235.1.14158 WP_003412235.1.14162 WP_003412235.1.14175 WP_003412235.1.14178 WP_003412235.1.14194 WP_003412235.1.14195 WP_003412235.1.14208 WP_003412235.1.14238 WP_003412235.1.14266 WP_003412235.1.14273 WP_003412235.1.14303 WP_003412235.1.14306 WP_003412235.1.14307 WP_003412235.1.14310 WP_003412235.1.14341 WP_003412235.1.14382 WP_003412235.1.14416 WP_003412235.1.14428 WP_003412235.1.14441 WP_003412235.1.14469 WP_003412235.1.14477 WP_003412235.1.14504 WP_003412235.1.14514 WP_003412235.1.1452 WP_003412235.1.14527 WP_003412235.1.1454 WP_003412235.1.14544 WP_003412235.1.14548 WP_003412235.1.14561 WP_003412235.1.14573 WP_003412235.1.1462 WP_003412235.1.14658 WP_003412235.1.14667 WP_003412235.1.14668 WP_003412235.1.14675 WP_003412235.1.14694 WP_003412235.1.14695 WP_003412235.1.14709 WP_003412235.1.14766 WP_003412235.1.14783 WP_003412235.1.14865 WP_003412235.1.14872 WP_003412235.1.14905 WP_003412235.1.14926 WP_003412235.1.14951 WP_003412235.1.14955 WP_003412235.1.15003 WP_003412235.1.15009 WP_003412235.1.15028 WP_003412235.1.15040 WP_003412235.1.15052 WP_003412235.1.15065 WP_003412235.1.15072 WP_003412235.1.15089 WP_003412235.1.1509 WP_003412235.1.15126 WP_003412235.1.15131 WP_003412235.1.15168 WP_003412235.1.15172 WP_003412235.1.15174 WP_003412235.1.15196 WP_003412235.1.15210 WP_003412235.1.15216 WP_003412235.1.15217 WP_003412235.1.1523 WP_003412235.1.15232 WP_003412235.1.15238 WP_003412235.1.15240 WP_003412235.1.15253 WP_003412235.1.15267 WP_003412235.1.1527 WP_003412235.1.15292 WP_003412235.1.15299 WP_003412235.1.15302 WP_003412235.1.15322 WP_003412235.1.1534 WP_003412235.1.15345 WP_003412235.1.15365 WP_003412235.1.15372 WP_003412235.1.15386 WP_003412235.1.15387 WP_003412235.1.15442 WP_003412235.1.15447 WP_003412235.1.15449 WP_003412235.1.15477 WP_003412235.1.15481 WP_003412235.1.15492 WP_003412235.1.15511 WP_003412235.1.15512 WP_003412235.1.15558 WP_003412235.1.15559 WP_003412235.1.15566 WP_003412235.1.15599 WP_003412235.1.1560 WP_003412235.1.15611 WP_003412235.1.1563 WP_003412235.1.15633 WP_003412235.1.15643 WP_003412235.1.15688 WP_003412235.1.15755 WP_003412235.1.15763 WP_003412235.1.15774 WP_003412235.1.1578 WP_003412235.1.15780 WP_003412235.1.15827 WP_003412235.1.15834 WP_003412235.1.15842 WP_003412235.1.15848 WP_003412235.1.15853 WP_003412235.1.15870 WP_003412235.1.15877 WP_003412235.1.15893 WP_003412235.1.15896 WP_003412235.1.15926 WP_003412235.1.15933 WP_003412235.1.15946 WP_003412235.1.15958 WP_003412235.1.15973 WP_003412235.1.15987 WP_003412235.1.15993 WP_003412235.1.16009 WP_003412235.1.16025 WP_003412235.1.16043 WP_003412235.1.16055 WP_003412235.1.16066 WP_003412235.1.16069 WP_003412235.1.16077 WP_003412235.1.16106 WP_003412235.1.16108 WP_003412235.1.16110 WP_003412235.1.16130 WP_003412235.1.16136 WP_003412235.1.16139 WP_003412235.1.16141 WP_003412235.1.16143 WP_003412235.1.1630 WP_003412235.1.16318 WP_003412235.1.1632 WP_003412235.1.16327 WP_003412235.1.16334 WP_003412235.1.16341 WP_003412235.1.16345 WP_003412235.1.16374 WP_003412235.1.16384 WP_003412235.1.16386 WP_003412235.1.164 WP_003412235.1.1642 WP_003412235.1.16421 WP_003412235.1.16424 WP_003412235.1.16426 WP_003412235.1.16431 WP_003412235.1.16438 WP_003412235.1.1644 WP_003412235.1.16442 WP_003412235.1.16448 WP_003412235.1.16451 WP_003412235.1.16476 WP_003412235.1.16480 WP_003412235.1.16494 WP_003412235.1.1652 WP_003412235.1.16549 WP_003412235.1.16560 WP_003412235.1.16598 WP_003412235.1.16609 WP_003412235.1.16619 WP_003412235.1.16620 WP_003412235.1.16622 WP_003412235.1.16637 WP_003412235.1.1669 WP_003412235.1.16707 WP_003412235.1.16724 WP_003412235.1.16731 WP_003412235.1.16743 WP_003412235.1.16837 WP_003412235.1.16852 WP_003412235.1.16937 WP_003412235.1.16940 WP_003412235.1.16950 WP_003412235.1.16959 WP_003412235.1.1697 WP_003412235.1.16973 WP_003412235.1.16977 WP_003412235.1.16987 WP_003412235.1.17005 WP_003412235.1.17006 WP_003412235.1.17010 WP_003412235.1.17015 WP_003412235.1.17019 WP_003412235.1.17039 WP_003412235.1.17041 WP_003412235.1.17052 WP_003412235.1.17057 WP_003412235.1.17062 WP_003412235.1.1707 WP_003412235.1.17094 WP_003412235.1.17130 WP_003412235.1.17147 WP_003412235.1.17167 WP_003412235.1.17224 WP_003412235.1.17251 WP_003412235.1.17288 WP_003412235.1.17304 WP_003412235.1.17314 WP_003412235.1.17345 WP_003412235.1.17381 WP_003412235.1.17412 WP_003412235.1.1743 WP_003412235.1.17440 WP_003412235.1.17466 WP_003412235.1.17477 WP_003412235.1.17483 WP_003412235.1.17505 WP_003412235.1.17527 WP_003412235.1.17535 WP_003412235.1.17540 WP_003412235.1.17553 WP_003412235.1.17558 WP_003412235.1.17599 WP_003412235.1.17635 WP_003412235.1.17655 WP_003412235.1.17679 WP_003412235.1.1768 WP_003412235.1.17687 WP_003412235.1.17700 WP_003412235.1.17710 WP_003412235.1.17713 WP_003412235.1.17746 WP_003412235.1.17788 WP_003412235.1.17798 WP_003412235.1.17821 WP_003412235.1.17830 WP_003412235.1.17868 WP_003412235.1.17878 WP_003412235.1.1792 WP_003412235.1.17923 WP_003412235.1.1795 WP_003412235.1.17955 WP_003412235.1.17973 WP_003412235.1.18009 WP_003412235.1.18013 WP_003412235.1.18033 WP_003412235.1.18057 WP_003412235.1.18065 WP_003412235.1.18070 WP_003412235.1.18116 WP_003412235.1.18120 WP_003412235.1.18126 WP_003412235.1.1817 WP_003412235.1.18170 WP_003412235.1.18206 WP_003412235.1.18216 WP_003412235.1.18240 WP_003412235.1.18257 WP_003412235.1.18297 WP_003412235.1.18306 WP_003412235.1.18364 WP_003412235.1.18399 WP_003412235.1.18411 WP_003412235.1.18444 WP_003412235.1.18448 WP_003412235.1.18467 WP_003412235.1.18476 WP_003412235.1.18522 WP_003412235.1.18580 WP_003412235.1.18582 WP_003412235.1.18587 WP_003412235.1.18601 WP_003412235.1.18639 WP_003412235.1.18646 WP_003412235.1.18647 WP_003412235.1.1868 WP_003412235.1.18694 WP_003412235.1.18710 WP_003412235.1.18751 WP_003412235.1.18781 WP_003412235.1.18793 WP_003412235.1.18804 WP_003412235.1.18816 WP_003412235.1.18823 WP_003412235.1.18827 WP_003412235.1.18838 WP_003412235.1.18849 WP_003412235.1.18856 WP_003412235.1.18945 WP_003412235.1.1898 WP_003412235.1.19056 WP_003412235.1.19063 WP_003412235.1.19066 WP_003412235.1.19071 WP_003412235.1.19085 WP_003412235.1.19094 WP_003412235.1.19144 WP_003412235.1.19159 WP_003412235.1.19193 WP_003412235.1.19231 WP_003412235.1.19243 WP_003412235.1.19264 WP_003412235.1.19295 WP_003412235.1.19307 WP_003412235.1.19326 WP_003412235.1.1933 WP_003412235.1.19364 WP_003412235.1.19382 WP_003412235.1.19400 WP_003412235.1.19426 WP_003412235.1.19429 WP_003412235.1.19464 WP_003412235.1.19480 WP_003412235.1.19512 WP_003412235.1.19553 WP_003412235.1.19562 WP_003412235.1.19564 WP_003412235.1.19568 WP_003412235.1.19572 WP_003412235.1.19595 WP_003412235.1.19596 WP_003412235.1.19600 WP_003412235.1.19630 WP_003412235.1.1967 WP_003412235.1.19694 WP_003412235.1.1970 WP_003412235.1.19707 WP_003412235.1.19742 WP_003412235.1.19785 WP_003412235.1.19820 WP_003412235.1.19868 WP_003412235.1.19874 WP_003412235.1.19900 WP_003412235.1.19922 WP_003412235.1.19936 WP_003412235.1.19946 WP_003412235.1.19949 WP_003412235.1.19960 WP_003412235.1.19964 WP_003412235.1.20007 WP_003412235.1.20016 WP_003412235.1.20028 WP_003412235.1.2003 WP_003412235.1.20037 WP_003412235.1.20039 WP_003412235.1.20082 WP_003412235.1.20085 WP_003412235.1.20097 WP_003412235.1.20116 WP_003412235.1.20130 WP_003412235.1.20140 WP_003412235.1.20141 WP_003412235.1.20142 WP_003412235.1.20158 WP_003412235.1.20239 WP_003412235.1.20243 WP_003412235.1.20259 WP_003412235.1.20262 WP_003412235.1.20268 WP_003412235.1.20272 WP_003412235.1.20280 WP_003412235.1.20294 WP_003412235.1.20300 WP_003412235.1.20309 WP_003412235.1.20322 WP_003412235.1.2037 WP_003412235.1.20372 WP_003412235.1.20381 WP_003412235.1.204 WP_003412235.1.20427 WP_003412235.1.20432 WP_003412235.1.20457 WP_003412235.1.20459 WP_003412235.1.20460 WP_003412235.1.20542 WP_003412235.1.20578 WP_003412235.1.20608 WP_003412235.1.20624 WP_003412235.1.2066 WP_003412235.1.20707 WP_003412235.1.20722 WP_003412235.1.20729 WP_003412235.1.20742 WP_003412235.1.20751 WP_003412235.1.20843 WP_003412235.1.20850 WP_003412235.1.2086 WP_003412235.1.20868 WP_003412235.1.20876 WP_003412235.1.20897 WP_003412235.1.20898 WP_003412235.1.2090 WP_003412235.1.20911 WP_003412235.1.20916 WP_003412235.1.20921 WP_003412235.1.20926 WP_003412235.1.20927 WP_003412235.1.20951 WP_003412235.1.20970 WP_003412235.1.2104 WP_003412235.1.21127 WP_003412235.1.21135 WP_003412235.1.21173 WP_003412235.1.21187 WP_003412235.1.212 WP_003412235.1.21218 WP_003412235.1.21219 WP_003412235.1.2123 WP_003412235.1.21231 WP_003412235.1.21234 WP_003412235.1.2126 WP_003412235.1.21292 WP_003412235.1.21307 WP_003412235.1.2131 WP_003412235.1.21311 WP_003412235.1.21321 WP_003412235.1.21365 WP_003412235.1.2137 WP_003412235.1.21392 WP_003412235.1.21397 WP_003412235.1.21403 WP_003412235.1.21415 WP_003412235.1.21418 WP_003412235.1.21430 WP_003412235.1.21434 WP_003412235.1.21444 WP_003412235.1.21468 WP_003412235.1.21498 WP_003412235.1.21509 WP_003412235.1.21513 WP_003412235.1.21565 WP_003412235.1.21586 WP_003412235.1.21591 WP_003412235.1.21594 WP_003412235.1.21602 WP_003412235.1.21615 WP_003412235.1.21638 WP_003412235.1.21639 WP_003412235.1.21655 WP_003412235.1.21658 WP_003412235.1.2168 WP_003412235.1.2174 WP_003412235.1.21741 WP_003412235.1.21777 WP_003412235.1.21786 WP_003412235.1.21795 WP_003412235.1.218 WP_003412235.1.21826 WP_003412235.1.21829 WP_003412235.1.21840 WP_003412235.1.21843 WP_003412235.1.21872 WP_003412235.1.21873 WP_003412235.1.2188 WP_003412235.1.21882 WP_003412235.1.21906 WP_003412235.1.21912 WP_003412235.1.2194 WP_003412235.1.21941 WP_003412235.1.21956 WP_003412235.1.21958 WP_003412235.1.21960 WP_003412235.1.21971 WP_003412235.1.21973 WP_003412235.1.21983 WP_003412235.1.22003 WP_003412235.1.22013 WP_003412235.1.22025 WP_003412235.1.22036 WP_003412235.1.22075 WP_003412235.1.22092 WP_003412235.1.2212 WP_003412235.1.22127 WP_003412235.1.22140 WP_003412235.1.22233 WP_003412235.1.22255 WP_003412235.1.22277 WP_003412235.1.22348 WP_003412235.1.22356 WP_003412235.1.22366 WP_003412235.1.22380 WP_003412235.1.22437 WP_003412235.1.22438 WP_003412235.1.22445 WP_003412235.1.22490 WP_003412235.1.22511 WP_003412235.1.22524 WP_003412235.1.2253 WP_003412235.1.22585 WP_003412235.1.22589 WP_003412235.1.22606 WP_003412235.1.22608 WP_003412235.1.22609 WP_003412235.1.22618 WP_003412235.1.2262 WP_003412235.1.22624 WP_003412235.1.22629 WP_003412235.1.22647 WP_003412235.1.22664 WP_003412235.1.22665 WP_003412235.1.22670 WP_003412235.1.22674 WP_003412235.1.22680 WP_003412235.1.22725 WP_003412235.1.22728 WP_003412235.1.22733 WP_003412235.1.22737 WP_003412235.1.2275 WP_003412235.1.22754 WP_003412235.1.22797 WP_003412235.1.22800 WP_003412235.1.22804 WP_003412235.1.22829 WP_003412235.1.22840 WP_003412235.1.22844 WP_003412235.1.22963 WP_003412235.1.22970 WP_003412235.1.22996 WP_003412235.1.22997 WP_003412235.1.22999 WP_003412235.1.23015 WP_003412235.1.23032 WP_003412235.1.231 WP_003412235.1.23101 WP_003412235.1.2312 WP_003412235.1.23140 WP_003412235.1.23153 WP_003412235.1.23171 WP_003412235.1.23199 WP_003412235.1.2320 WP_003412235.1.23204 WP_003412235.1.23216 WP_003412235.1.23229 WP_003412235.1.23233 WP_003412235.1.2326 WP_003412235.1.23261 WP_003412235.1.2329 WP_003412235.1.23308 WP_003412235.1.23316 WP_003412235.1.23321 WP_003412235.1.23325 WP_003412235.1.2339 WP_003412235.1.23406 WP_003412235.1.23438 WP_003412235.1.23445 WP_003412235.1.23447 WP_003412235.1.23452 WP_003412235.1.2349 WP_003412235.1.23496 WP_003412235.1.23497 WP_003412235.1.23506 WP_003412235.1.23530 WP_003412235.1.23539 WP_003412235.1.23546 WP_003412235.1.23551 WP_003412235.1.23573 WP_003412235.1.23583 WP_003412235.1.23588 WP_003412235.1.23628 WP_003412235.1.23677 WP_003412235.1.23683 WP_003412235.1.23692 WP_003412235.1.23694 WP_003412235.1.23699 WP_003412235.1.2371 WP_003412235.1.23803 WP_003412235.1.23807 WP_003412235.1.23825 WP_003412235.1.23832 WP_003412235.1.2384 WP_003412235.1.23843 WP_003412235.1.23863 WP_003412235.1.2387 WP_003412235.1.23894 WP_003412235.1.2400 WP_003412235.1.24007 WP_003412235.1.24008 WP_003412235.1.24046 WP_003412235.1.24057 WP_003412235.1.24062 WP_003412235.1.24128 WP_003412235.1.24140 WP_003412235.1.24176 WP_003412235.1.24190 WP_003412235.1.24202 WP_003412235.1.24244 WP_003412235.1.24261 WP_003412235.1.24284 WP_003412235.1.24294 WP_003412235.1.24357 WP_003412235.1.24396 WP_003412235.1.24414 WP_003412235.1.24423 WP_003412235.1.2443 WP_003412235.1.24446 WP_003412235.1.24461 WP_003412235.1.24500 WP_003412235.1.24509 WP_003412235.1.24529 WP_003412235.1.24553 WP_003412235.1.24629 WP_003412235.1.24638 WP_003412235.1.24648 WP_003412235.1.2466 WP_003412235.1.24767 WP_003412235.1.24824 WP_003412235.1.24831 WP_003412235.1.24840 WP_003412235.1.24848 WP_003412235.1.24857 WP_003412235.1.2487 WP_003412235.1.24893 WP_003412235.1.24907 WP_003412235.1.24933 WP_003412235.1.24956 WP_003412235.1.24958 WP_003412235.1.24985 WP_003412235.1.2499 WP_003412235.1.25004 WP_003412235.1.2505 WP_003412235.1.25051 WP_003412235.1.2507 WP_003412235.1.25096 WP_003412235.1.25103 WP_003412235.1.25129 WP_003412235.1.25171 WP_003412235.1.25184 WP_003412235.1.25247 WP_003412235.1.25252 WP_003412235.1.25278 WP_003412235.1.25283 WP_003412235.1.25309 WP_003412235.1.25313 WP_003412235.1.25338 WP_003412235.1.25342 WP_003412235.1.25343 WP_003412235.1.25367 WP_003412235.1.25393 WP_003412235.1.25406 WP_003412235.1.25435 WP_003412235.1.25437 WP_003412235.1.25445 WP_003412235.1.25455 WP_003412235.1.25473 WP_003412235.1.25513 WP_003412235.1.25542 WP_003412235.1.25579 WP_003412235.1.25594 WP_003412235.1.25606 WP_003412235.1.25645 WP_003412235.1.2566 WP_003412235.1.25673 WP_003412235.1.25693 WP_003412235.1.25699 WP_003412235.1.25727 WP_003412235.1.25736 WP_003412235.1.25738 WP_003412235.1.25756 WP_003412235.1.25759 WP_003412235.1.2580 WP_003412235.1.25813 WP_003412235.1.25853 WP_003412235.1.25854 WP_003412235.1.25874 WP_003412235.1.25885 WP_003412235.1.25892 WP_003412235.1.25906 WP_003412235.1.25914 WP_003412235.1.25916 WP_003412235.1.2594 WP_003412235.1.25954 WP_003412235.1.25965 WP_003412235.1.25972 WP_003412235.1.26017 WP_003412235.1.26032 WP_003412235.1.26038 WP_003412235.1.26072 WP_003412235.1.26089 WP_003412235.1.26097 WP_003412235.1.26098 WP_003412235.1.26108 WP_003412235.1.26118 WP_003412235.1.26126 WP_003412235.1.2614 WP_003412235.1.26168 WP_003412235.1.26182 WP_003412235.1.26190 WP_003412235.1.2620 WP_003412235.1.26234 WP_003412235.1.26243 WP_003412235.1.26265 WP_003412235.1.26267 WP_003412235.1.26292 WP_003412235.1.26310 WP_003412235.1.26328 WP_003412235.1.26349 WP_003412235.1.26366 WP_003412235.1.26374 WP_003412235.1.26407 WP_003412235.1.26412 WP_003412235.1.26454 WP_003412235.1.26464 WP_003412235.1.2653 WP_003412235.1.26571 WP_003412235.1.2659 WP_003412235.1.26597 WP_003412235.1.26629 WP_003412235.1.26651 WP_003412235.1.26702 WP_003412235.1.26707 WP_003412235.1.26710 WP_003412235.1.26737 WP_003412235.1.26738 WP_003412235.1.26745 WP_003412235.1.26756 WP_003412235.1.2676 WP_003412235.1.26779 WP_003412235.1.26780 WP_003412235.1.26798 WP_003412235.1.26854 WP_003412235.1.26868 WP_003412235.1.26876 WP_003412235.1.26888 WP_003412235.1.26914 WP_003412235.1.26945 WP_003412235.1.26959 WP_003412235.1.26984 WP_003412235.1.26992 WP_003412235.1.27017 WP_003412235.1.27045 WP_003412235.1.27074 WP_003412235.1.27075 WP_003412235.1.27128 WP_003412235.1.27130 WP_003412235.1.27139 WP_003412235.1.27152 WP_003412235.1.27162 WP_003412235.1.27164 WP_003412235.1.27193 WP_003412235.1.27235 WP_003412235.1.27254 WP_003412235.1.27278 WP_003412235.1.27343 WP_003412235.1.27352 WP_003412235.1.27369 WP_003412235.1.27391 WP_003412235.1.27398 WP_003412235.1.27402 WP_003412235.1.27410 WP_003412235.1.27411 WP_003412235.1.27449 WP_003412235.1.27460 WP_003412235.1.27463 WP_003412235.1.2749 WP_003412235.1.27492 WP_003412235.1.27528 WP_003412235.1.27541 WP_003412235.1.27576 WP_003412235.1.27582 WP_003412235.1.27596 WP_003412235.1.27607 WP_003412235.1.2766 WP_003412235.1.277 WP_003412235.1.27724 WP_003412235.1.27730 WP_003412235.1.27736 WP_003412235.1.27743 WP_003412235.1.27750 WP_003412235.1.27771 WP_003412235.1.27779 WP_003412235.1.27795 WP_003412235.1.27803 WP_003412235.1.27819 WP_003412235.1.27835 WP_003412235.1.27915 WP_003412235.1.27935 WP_003412235.1.27962 WP_003412235.1.28053 WP_003412235.1.28092 WP_003412235.1.28106 WP_003412235.1.28131 WP_003412235.1.28142 WP_003412235.1.28159 WP_003412235.1.2816 WP_003412235.1.28161 WP_003412235.1.28192 WP_003412235.1.28202 WP_003412235.1.28241 WP_003412235.1.28242 WP_003412235.1.28251 WP_003412235.1.28269 WP_003412235.1.28276 WP_003412235.1.28293 WP_003412235.1.28331 WP_003412235.1.28367 WP_003412235.1.28378 WP_003412235.1.28391 WP_003412235.1.2842 WP_003412235.1.28448 WP_003412235.1.2847 WP_003412235.1.28471 WP_003412235.1.28473 WP_003412235.1.28493 WP_003412235.1.28497 WP_003412235.1.28530 WP_003412235.1.28545 WP_003412235.1.28561 WP_003412235.1.28567 WP_003412235.1.28585 WP_003412235.1.286 WP_003412235.1.28610 WP_003412235.1.28617 WP_003412235.1.28634 WP_003412235.1.28642 WP_003412235.1.28671 WP_003412235.1.28682 WP_003412235.1.28698 WP_003412235.1.28703 WP_003412235.1.28739 WP_003412235.1.28781 WP_003412235.1.28787 WP_003412235.1.28827 WP_003412235.1.28839 WP_003412235.1.28847 WP_003412235.1.28850 WP_003412235.1.28851 WP_003412235.1.28865 WP_003412235.1.28897 WP_003412235.1.28914 WP_003412235.1.28935 WP_003412235.1.28936 WP_003412235.1.28939 WP_003412235.1.28943 WP_003412235.1.28952 WP_003412235.1.28975 WP_003412235.1.2899 WP_003412235.1.28993 WP_003412235.1.29000 WP_003412235.1.2901 WP_003412235.1.29028 WP_003412235.1.29033 WP_003412235.1.29058 WP_003412235.1.29078 WP_003412235.1.29102 WP_003412235.1.29115 WP_003412235.1.2916 WP_003412235.1.29217 WP_003412235.1.29223 WP_003412235.1.29234 WP_003412235.1.29264 WP_003412235.1.29275 WP_003412235.1.29306 WP_003412235.1.29339 WP_003412235.1.29348 WP_003412235.1.29364 WP_003412235.1.29367 WP_003412235.1.29399 WP_003412235.1.29426 WP_003412235.1.2944 WP_003412235.1.29449 WP_003412235.1.29450 WP_003412235.1.29452 WP_003412235.1.2949 WP_003412235.1.29515 WP_003412235.1.29525 WP_003412235.1.2953 WP_003412235.1.29559 WP_003412235.1.29587 WP_003412235.1.29592 WP_003412235.1.29599 WP_003412235.1.29611 WP_003412235.1.29632 WP_003412235.1.29649 WP_003412235.1.2965 WP_003412235.1.29659 WP_003412235.1.2969 WP_003412235.1.29696 WP_003412235.1.29698 WP_003412235.1.29718 WP_003412235.1.29745 WP_003412235.1.29747 WP_003412235.1.29769 WP_003412235.1.29825 WP_003412235.1.29830 WP_003412235.1.29847 WP_003412235.1.29861 WP_003412235.1.29869 WP_003412235.1.29883 WP_003412235.1.29890 WP_003412235.1.299 WP_003412235.1.29931 WP_003412235.1.29960 WP_003412235.1.30014 WP_003412235.1.3004 WP_003412235.1.30043 WP_003412235.1.30097 WP_003412235.1.30101 WP_003412235.1.30106 WP_003412235.1.30114 WP_003412235.1.30126 WP_003412235.1.30131 WP_003412235.1.30139 WP_003412235.1.30211 WP_003412235.1.30224 WP_003412235.1.30235 WP_003412235.1.30237 WP_003412235.1.3027 WP_003412235.1.30279 WP_003412235.1.30282 WP_003412235.1.30283 WP_003412235.1.30288 WP_003412235.1.30291 WP_003412235.1.30363 WP_003412235.1.30374 WP_003412235.1.30404 WP_003412235.1.3043 WP_003412235.1.30438 WP_003412235.1.30462 WP_003412235.1.30464 WP_003412235.1.30468 WP_003412235.1.30500 WP_003412235.1.3057 WP_003412235.1.30574 WP_003412235.1.30628 WP_003412235.1.30641 WP_003412235.1.30642 WP_003412235.1.30661 WP_003412235.1.30669 WP_003412235.1.30683 WP_003412235.1.30699 WP_003412235.1.30709 WP_003412235.1.30713 WP_003412235.1.30716 WP_003412235.1.30719 WP_003412235.1.30730 WP_003412235.1.30732 WP_003412235.1.30736 WP_003412235.1.30760 WP_003412235.1.30791 WP_003412235.1.308 WP_003412235.1.30807 WP_003412235.1.30818 WP_003412235.1.30848 WP_003412235.1.30877 WP_003412235.1.30888 WP_003412235.1.30901 WP_003412235.1.30903 WP_003412235.1.30912 WP_003412235.1.30913 WP_003412235.1.30914 WP_003412235.1.30919 WP_003412235.1.30977 WP_003412235.1.3100 WP_003412235.1.31002 WP_003412235.1.3101 WP_003412235.1.31034 WP_003412235.1.31047 WP_003412235.1.31070 WP_003412235.1.31074 WP_003412235.1.31102 WP_003412235.1.31127 WP_003412235.1.31184 WP_003412235.1.31199 WP_003412235.1.31226 WP_003412235.1.31230 WP_003412235.1.31233 WP_003412235.1.31263 WP_003412235.1.31264 WP_003412235.1.31270 WP_003412235.1.31287 WP_003412235.1.31290 WP_003412235.1.31346 WP_003412235.1.31348 WP_003412235.1.31354 WP_003412235.1.31390 WP_003412235.1.31414 WP_003412235.1.31417 WP_003412235.1.31428 WP_003412235.1.3143 WP_003412235.1.31458 WP_003412235.1.31483 WP_003412235.1.3149 WP_003412235.1.31498 WP_003412235.1.31507 WP_003412235.1.31537 WP_003412235.1.31548 WP_003412235.1.31569 WP_003412235.1.31573 WP_003412235.1.316 WP_003412235.1.31629 WP_003412235.1.31666 WP_003412235.1.31693 WP_003412235.1.31703 WP_003412235.1.31744 WP_003412235.1.31770 WP_003412235.1.31776 WP_003412235.1.31783 WP_003412235.1.318 WP_003412235.1.3184 WP_003412235.1.31840 WP_003412235.1.31880 WP_003412235.1.31911 WP_003412235.1.31930 WP_003412235.1.31932 WP_003412235.1.31985 WP_003412235.1.31991 WP_003412235.1.31995 WP_003412235.1.32004 WP_003412235.1.32039 WP_003412235.1.3204 WP_003412235.1.32045 WP_003412235.1.32071 WP_003412235.1.32098 WP_003412235.1.32132 WP_003412235.1.32157 WP_003412235.1.32164 WP_003412235.1.32179 WP_003412235.1.32198 WP_003412235.1.32297 WP_003412235.1.32383 WP_003412235.1.32400 WP_003412235.1.32403 WP_003412235.1.32416 WP_003412235.1.32421 WP_003412235.1.32433 WP_003412235.1.32461 WP_003412235.1.32482 WP_003412235.1.32503 WP_003412235.1.32556 WP_003412235.1.32562 WP_003412235.1.32569 WP_003412235.1.32592 WP_003412235.1.32620 WP_003412235.1.32647 WP_003412235.1.32653 WP_003412235.1.32654 WP_003412235.1.3268 WP_003412235.1.32695 WP_003412235.1.32706 WP_003412235.1.32716 WP_003412235.1.32738 WP_003412235.1.32752 WP_003412235.1.32780 WP_003412235.1.32781 WP_003412235.1.32793 WP_003412235.1.32799 WP_003412235.1.32822 WP_003412235.1.32833 WP_003412235.1.32862 WP_003412235.1.32880 WP_003412235.1.32897 WP_003412235.1.32909 WP_003412235.1.32935 WP_003412235.1.32974 WP_003412235.1.33007 WP_003412235.1.3302 WP_003412235.1.33028 WP_003412235.1.33035 WP_003412235.1.33044 WP_003412235.1.33054 WP_003412235.1.33082 WP_003412235.1.33141 WP_003412235.1.33148 WP_003412235.1.33155 WP_003412235.1.33168 WP_003412235.1.3321 WP_003412235.1.33215 WP_003412235.1.3325 WP_003412235.1.3327 WP_003412235.1.33278 WP_003412235.1.33305 WP_003412235.1.3331 WP_003412235.1.33319 WP_003412235.1.3333 WP_003412235.1.33393 WP_003412235.1.33403 WP_003412235.1.33452 WP_003412235.1.33467 WP_003412235.1.33477 WP_003412235.1.3349 WP_003412235.1.33519 WP_003412235.1.33542 WP_003412235.1.33601 WP_003412235.1.33602 WP_003412235.1.33633 WP_003412235.1.33673 WP_003412235.1.3369 WP_003412235.1.33705 WP_003412235.1.33762 WP_003412235.1.33783 WP_003412235.1.33789 WP_003412235.1.33832 WP_003412235.1.33839 WP_003412235.1.33848 WP_003412235.1.3387 WP_003412235.1.33886 WP_003412235.1.33895 WP_003412235.1.33906 WP_003412235.1.33912 WP_003412235.1.33954 WP_003412235.1.3399 WP_003412235.1.34042 WP_003412235.1.3405 WP_003412235.1.34055 WP_003412235.1.34056 WP_003412235.1.34065 WP_003412235.1.3408 WP_003412235.1.34111 WP_003412235.1.34131 WP_003412235.1.34152 WP_003412235.1.34153 WP_003412235.1.34163 WP_003412235.1.34181 WP_003412235.1.34197 WP_003412235.1.34198 WP_003412235.1.34215 WP_003412235.1.34219 WP_003412235.1.34255 WP_003412235.1.34260 WP_003412235.1.34275 WP_003412235.1.343 WP_003412235.1.34347 WP_003412235.1.34358 WP_003412235.1.34392 WP_003412235.1.344 WP_003412235.1.34428 WP_003412235.1.3443 WP_003412235.1.34435 WP_003412235.1.34499 WP_003412235.1.34505 WP_003412235.1.34551 WP_003412235.1.34563 WP_003412235.1.34576 WP_003412235.1.34581 WP_003412235.1.34588 WP_003412235.1.34596 WP_003412235.1.34599 WP_003412235.1.34639 WP_003412235.1.34673 WP_003412235.1.34724 WP_003412235.1.34740 WP_003412235.1.34755 WP_003412235.1.34777 WP_003412235.1.34783 WP_003412235.1.34841 WP_003412235.1.34908 WP_003412235.1.34919 WP_003412235.1.3492 WP_003412235.1.34933 WP_003412235.1.34945 WP_003412235.1.34946 WP_003412235.1.34954 WP_003412235.1.34960 WP_003412235.1.34961 WP_003412235.1.34963 WP_003412235.1.34965 WP_003412235.1.34968 WP_003412235.1.35023 WP_003412235.1.35069 WP_003412235.1.35072 WP_003412235.1.35078 WP_003412235.1.35100 WP_003412235.1.35146 WP_003412235.1.35156 WP_003412235.1.35160 WP_003412235.1.35162 WP_003412235.1.35173 WP_003412235.1.35176 WP_003412235.1.35213 WP_003412235.1.35221 WP_003412235.1.35246 WP_003412235.1.35278 WP_003412235.1.35301 WP_003412235.1.35311 WP_003412235.1.35312 WP_003412235.1.35317 WP_003412235.1.35319 WP_003412235.1.35347 WP_003412235.1.35363 WP_003412235.1.35382 WP_003412235.1.35385 WP_003412235.1.35396 WP_003412235.1.35403 WP_003412235.1.35426 WP_003412235.1.35455 WP_003412235.1.3548 WP_003412235.1.35484 WP_003412235.1.35492 WP_003412235.1.3553 WP_003412235.1.35553 WP_003412235.1.35561 WP_003412235.1.35602 WP_003412235.1.35610 WP_003412235.1.35635 WP_003412235.1.35657 WP_003412235.1.35680 WP_003412235.1.35687 WP_003412235.1.35689 WP_003412235.1.35707 WP_003412235.1.35732 WP_003412235.1.35754 WP_003412235.1.35767 WP_003412235.1.35770 WP_003412235.1.35771 WP_003412235.1.35780 WP_003412235.1.35805 WP_003412235.1.35811 WP_003412235.1.35821 WP_003412235.1.3584 WP_003412235.1.35848 WP_003412235.1.35864 WP_003412235.1.35874 WP_003412235.1.35876 WP_003412235.1.35897 WP_003412235.1.35899 WP_003412235.1.35923 WP_003412235.1.3593 WP_003412235.1.35954 WP_003412235.1.36005 WP_003412235.1.36014 WP_003412235.1.36023 WP_003412235.1.36051 WP_003412235.1.36053 WP_003412235.1.36075 WP_003412235.1.36089 WP_003412235.1.36097 WP_003412235.1.36098 WP_003412235.1.36116 WP_003412235.1.36145 WP_003412235.1.36156 WP_003412235.1.36205 WP_003412235.1.36228 WP_003412235.1.36246 WP_003412235.1.36252 WP_003412235.1.36260 WP_003412235.1.36270 WP_003412235.1.36271 WP_003412235.1.36303 WP_003412235.1.36309 WP_003412235.1.36319 WP_003412235.1.36321 WP_003412235.1.36326 WP_003412235.1.3634 WP_003412235.1.36356 WP_003412235.1.36357 WP_003412235.1.3636 WP_003412235.1.36385 WP_003412235.1.36399 WP_003412235.1.36436 WP_003412235.1.36465 WP_003412235.1.36469 WP_003412235.1.36473 WP_003412235.1.36485 WP_003412235.1.36508 WP_003412235.1.36540 WP_003412235.1.36561 WP_003412235.1.36571 WP_003412235.1.36573 WP_003412235.1.36578 WP_003412235.1.36585 WP_003412235.1.36597 WP_003412235.1.36614 WP_003412235.1.36657 WP_003412235.1.36674 WP_003412235.1.36727 WP_003412235.1.36733 WP_003412235.1.36785 WP_003412235.1.36810 WP_003412235.1.36844 WP_003412235.1.36851 WP_003412235.1.36862 WP_003412235.1.36893 WP_003412235.1.36901 WP_003412235.1.36921 WP_003412235.1.36935 WP_003412235.1.36941 WP_003412235.1.3695 WP_003412235.1.36951 WP_003412235.1.36968 WP_003412235.1.3700 WP_003412235.1.37004 WP_003412235.1.37012 WP_003412235.1.37071 WP_003412235.1.37088 WP_003412235.1.37131 WP_003412235.1.37157 WP_003412235.1.37175 WP_003412235.1.37188 WP_003412235.1.37213 WP_003412235.1.37229 WP_003412235.1.3724 WP_003412235.1.37277 WP_003412235.1.37305 WP_003412235.1.37330 WP_003412235.1.37389 WP_003412235.1.37400 WP_003412235.1.37440 WP_003412235.1.37459 WP_003412235.1.37468 WP_003412235.1.37475 WP_003412235.1.37484 WP_003412235.1.37601 WP_003412235.1.37612 WP_003412235.1.37632 WP_003412235.1.37643 WP_003412235.1.37655 WP_003412235.1.37660 WP_003412235.1.37674 WP_003412235.1.37700 WP_003412235.1.37701 WP_003412235.1.37709 WP_003412235.1.37711 WP_003412235.1.37721 WP_003412235.1.37722 WP_003412235.1.37747 WP_003412235.1.37765 WP_003412235.1.37772 WP_003412235.1.37804 WP_003412235.1.37809 WP_003412235.1.37859 WP_003412235.1.37877 WP_003412235.1.37912 WP_003412235.1.37913 WP_003412235.1.37943 WP_003412235.1.37950 WP_003412235.1.37973 WP_003412235.1.37975 WP_003412235.1.37983 WP_003412235.1.38 WP_003412235.1.38002 WP_003412235.1.3802 WP_003412235.1.38039 WP_003412235.1.38040 WP_003412235.1.38067 WP_003412235.1.38068 WP_003412235.1.38135 WP_003412235.1.38138 WP_003412235.1.38144 WP_003412235.1.38158 WP_003412235.1.38210 WP_003412235.1.38233 WP_003412235.1.38240 WP_003412235.1.38332 WP_003412235.1.38347 WP_003412235.1.38354 WP_003412235.1.38380 WP_003412235.1.38384 WP_003412235.1.38389 WP_003412235.1.38398 WP_003412235.1.38402 WP_003412235.1.38421 WP_003412235.1.38466 WP_003412235.1.38483 WP_003412235.1.3849 WP_003412235.1.385 WP_003412235.1.38530 WP_003412235.1.38535 WP_003412235.1.38539 WP_003412235.1.38594 WP_003412235.1.38601 WP_003412235.1.38611 WP_003412235.1.38638 WP_003412235.1.38639 WP_003412235.1.38646 WP_003412235.1.38648 WP_003412235.1.38654 WP_003412235.1.38659 WP_003412235.1.38660 WP_003412235.1.38666 WP_003412235.1.38671 WP_003412235.1.38672 WP_003412235.1.38677 WP_003412235.1.38750 WP_003412235.1.38772 WP_003412235.1.38812 WP_003412235.1.38821 WP_003412235.1.38844 WP_003412235.1.38863 WP_003412235.1.38873 WP_003412235.1.3889 WP_003412235.1.38894 WP_003412235.1.38909 WP_003412235.1.38939 WP_003412235.1.38974 WP_003412235.1.38975 WP_003412235.1.38991 WP_003412235.1.39025 WP_003412235.1.39070 WP_003412235.1.39072 WP_003412235.1.39095 WP_003412235.1.39106 WP_003412235.1.39165 WP_003412235.1.39174 WP_003412235.1.39176 WP_003412235.1.39178 WP_003412235.1.39190 WP_003412235.1.39201 WP_003412235.1.39207 WP_003412235.1.39211 WP_003412235.1.39236 WP_003412235.1.39239 WP_003412235.1.39252 WP_003412235.1.39288 WP_003412235.1.39295 WP_003412235.1.39306 WP_003412235.1.39359 WP_003412235.1.39364 WP_003412235.1.39400 WP_003412235.1.39447 WP_003412235.1.3945 WP_003412235.1.39450 WP_003412235.1.39455 WP_003412235.1.3949 WP_003412235.1.39521 WP_003412235.1.39560 WP_003412235.1.39592 WP_003412235.1.39593 WP_003412235.1.396 WP_003412235.1.3960 WP_003412235.1.39616 WP_003412235.1.39654 WP_003412235.1.39657 WP_003412235.1.39661 WP_003412235.1.39674 WP_003412235.1.39678 WP_003412235.1.3968 WP_003412235.1.39694 WP_003412235.1.3971 WP_003412235.1.39718 WP_003412235.1.39728 WP_003412235.1.39739 WP_003412235.1.39748 WP_003412235.1.39751 WP_003412235.1.39759 WP_003412235.1.39801 WP_003412235.1.39804 WP_003412235.1.39848 WP_003412235.1.39877 WP_003412235.1.39925 WP_003412235.1.3994 WP_003412235.1.39959 WP_003412235.1.3996 WP_003412235.1.39960 WP_003412235.1.3997 WP_003412235.1.39980 WP_003412235.1.40000 WP_003412235.1.40028 WP_003412235.1.40029 WP_003412235.1.4003 WP_003412235.1.40094 WP_003412235.1.40096 WP_003412235.1.40150 WP_003412235.1.40156 WP_003412235.1.40174 WP_003412235.1.40186 WP_003412235.1.40276 WP_003412235.1.40277 WP_003412235.1.40323 WP_003412235.1.40336 WP_003412235.1.40353 WP_003412235.1.4036 WP_003412235.1.40372 WP_003412235.1.40402 WP_003412235.1.40413 WP_003412235.1.40440 WP_003412235.1.40446 WP_003412235.1.40451 WP_003412235.1.40455 WP_003412235.1.40523 WP_003412235.1.40543 WP_003412235.1.40641 WP_003412235.1.40646 WP_003412235.1.40651 WP_003412235.1.40653 WP_003412235.1.4067 WP_003412235.1.40705 WP_003412235.1.40723 WP_003412235.1.40735 WP_003412235.1.40799 WP_003412235.1.40852 WP_003412235.1.40876 WP_003412235.1.40881 WP_003412235.1.40922 WP_003412235.1.40948 WP_003412235.1.4095 WP_003412235.1.40956 WP_003412235.1.40957 WP_003412235.1.4097 WP_003412235.1.410 WP_003412235.1.41000 WP_003412235.1.41055 WP_003412235.1.41108 WP_003412235.1.41123 WP_003412235.1.41177 WP_003412235.1.41202 WP_003412235.1.41219 WP_003412235.1.41231 WP_003412235.1.41249 WP_003412235.1.4127 WP_003412235.1.41296 WP_003412235.1.41355 WP_003412235.1.41430 WP_003412235.1.41447 WP_003412235.1.41469 WP_003412235.1.41504 WP_003412235.1.41553 WP_003412235.1.41564 WP_003412235.1.41583 WP_003412235.1.41616 WP_003412235.1.41632 WP_003412235.1.41635 WP_003412235.1.41636 WP_003412235.1.41648 WP_003412235.1.41660 WP_003412235.1.41685 WP_003412235.1.41695 WP_003412235.1.41704 WP_003412235.1.41719 WP_003412235.1.41733 WP_003412235.1.41744 WP_003412235.1.41774 WP_003412235.1.41791 WP_003412235.1.41803 WP_003412235.1.41820 WP_003412235.1.41828 WP_003412235.1.41829 WP_003412235.1.41860 WP_003412235.1.41912 WP_003412235.1.41921 WP_003412235.1.41933 WP_003412235.1.41944 WP_003412235.1.42043 WP_003412235.1.42075 WP_003412235.1.42078 WP_003412235.1.42094 WP_003412235.1.42112 WP_003412235.1.4212 WP_003412235.1.42122 WP_003412235.1.42134 WP_003412235.1.42188 WP_003412235.1.42201 WP_003412235.1.42202 WP_003412235.1.42247 WP_003412235.1.42255 WP_003412235.1.42273 WP_003412235.1.42278 WP_003412235.1.42304 WP_003412235.1.42309 WP_003412235.1.42370 WP_003412235.1.42385 WP_003412235.1.42400 WP_003412235.1.42409 WP_003412235.1.42414 WP_003412235.1.42417 WP_003412235.1.42430 WP_003412235.1.42461 WP_003412235.1.42465 WP_003412235.1.42467 WP_003412235.1.42473 WP_003412235.1.4248 WP_003412235.1.42494 WP_003412235.1.42519 WP_003412235.1.42524 WP_003412235.1.42534 WP_003412235.1.4255 WP_003412235.1.42562 WP_003412235.1.42568 WP_003412235.1.42570 WP_003412235.1.42618 WP_003412235.1.42660 WP_003412235.1.42695 WP_003412235.1.42704 WP_003412235.1.42705 WP_003412235.1.42722 WP_003412235.1.42777 WP_003412235.1.42782 WP_003412235.1.42835 WP_003412235.1.42839 WP_003412235.1.42842 WP_003412235.1.42905 WP_003412235.1.42916 WP_003412235.1.42930 WP_003412235.1.42971 WP_003412235.1.43005 WP_003412235.1.43009 WP_003412235.1.43053 WP_003412235.1.43082 WP_003412235.1.43087 WP_003412235.1.43098 WP_003412235.1.43208 WP_003412235.1.43236 WP_003412235.1.43246 WP_003412235.1.43255 WP_003412235.1.43266 WP_003412235.1.43273 WP_003412235.1.43296 WP_003412235.1.43306 WP_003412235.1.4335 WP_003412235.1.43368 WP_003412235.1.43395 WP_003412235.1.43457 WP_003412235.1.43475 WP_003412235.1.43478 WP_003412235.1.43484 WP_003412235.1.43557 WP_003412235.1.43578 WP_003412235.1.43588 WP_003412235.1.43643 WP_003412235.1.43664 WP_003412235.1.43684 WP_003412235.1.43686 WP_003412235.1.43706 WP_003412235.1.43716 WP_003412235.1.4377 WP_003412235.1.43781 WP_003412235.1.43794 WP_003412235.1.43815 WP_003412235.1.43846 WP_003412235.1.43861 WP_003412235.1.43863 WP_003412235.1.43866 WP_003412235.1.43872 WP_003412235.1.43885 WP_003412235.1.43897 WP_003412235.1.4390 WP_003412235.1.43902 WP_003412235.1.43921 WP_003412235.1.43936 WP_003412235.1.43937 WP_003412235.1.43960 WP_003412235.1.43965 WP_003412235.1.4399 WP_003412235.1.43993 WP_003412235.1.43996 WP_003412235.1.44 WP_003412235.1.44001 WP_003412235.1.44008 WP_003412235.1.44016 WP_003412235.1.44033 WP_003412235.1.44037 WP_003412235.1.44041 WP_003412235.1.44070 WP_003412235.1.44071 WP_003412235.1.44076 WP_003412235.1.44104 WP_003412235.1.44111 WP_003412235.1.44124 WP_003412235.1.44169 WP_003412235.1.44219 WP_003412235.1.44237 WP_003412235.1.44277 WP_003412235.1.44279 WP_003412235.1.44336 WP_003412235.1.44355 WP_003412235.1.44358 WP_003412235.1.4438 WP_003412235.1.44390 WP_003412235.1.44392 WP_003412235.1.4441 WP_003412235.1.44415 WP_003412235.1.44464 WP_003412235.1.44466 WP_003412235.1.44489 WP_003412235.1.44492 WP_003412235.1.44494 WP_003412235.1.44500 WP_003412235.1.44519 WP_003412235.1.44526 WP_003412235.1.44532 WP_003412235.1.44534 WP_003412235.1.44562 WP_003412235.1.44589 WP_003412235.1.44597 WP_003412235.1.44600 WP_003412235.1.44602 WP_003412235.1.44615 WP_003412235.1.4464 WP_003412235.1.44651 WP_003412235.1.44659 WP_003412235.1.44665 WP_003412235.1.44694 WP_003412235.1.44700 WP_003412235.1.44713 WP_003412235.1.44735 WP_003412235.1.44740 WP_003412235.1.44757 WP_003412235.1.4476 WP_003412235.1.44761 WP_003412235.1.44767 WP_003412235.1.44776 WP_003412235.1.44779 WP_003412235.1.44786 WP_003412235.1.44864 WP_003412235.1.44901 WP_003412235.1.44908 WP_003412235.1.44913 WP_003412235.1.4492 WP_003412235.1.44939 WP_003412235.1.44979 WP_003412235.1.44981 WP_003412235.1.45002 WP_003412235.1.45011 WP_003412235.1.4504 WP_003412235.1.45062 WP_003412235.1.45066 WP_003412235.1.45081 WP_003412235.1.45113 WP_003412235.1.45129 WP_003412235.1.45135 WP_003412235.1.45147 WP_003412235.1.45168 WP_003412235.1.4517 WP_003412235.1.45181 WP_003412235.1.45185 WP_003412235.1.45192 WP_003412235.1.45200 WP_003412235.1.45205 WP_003412235.1.45211 WP_003412235.1.45249 WP_003412235.1.4526 WP_003412235.1.45286 WP_003412235.1.45347 WP_003412235.1.45374 WP_003412235.1.45390 WP_003412235.1.454 WP_003412235.1.45407 WP_003412235.1.45451 WP_003412235.1.45453 WP_003412235.1.45460 WP_003412235.1.45463 WP_003412235.1.45470 WP_003412235.1.45474 WP_003412235.1.45491 WP_003412235.1.45510 WP_003412235.1.45563 WP_003412235.1.45584 WP_003412235.1.45590 WP_003412235.1.45619 WP_003412235.1.45626 WP_003412235.1.45631 WP_003412235.1.45666 WP_003412235.1.45697 WP_003412235.1.4571 WP_003412235.1.45731 WP_003412235.1.45765 WP_003412235.1.45783 WP_003412235.1.45805 WP_003412235.1.45815 WP_003412235.1.45849 WP_003412235.1.45867 WP_003412235.1.45884 WP_003412235.1.45926 WP_003412235.1.45963 WP_003412235.1.45989 WP_003412235.1.45992 WP_003412235.1.46025 WP_003412235.1.46083 WP_003412235.1.46090 WP_003412235.1.46092 WP_003412235.1.46100 WP_003412235.1.46101 WP_003412235.1.46103 WP_003412235.1.46107 WP_003412235.1.46128 WP_003412235.1.46129 WP_003412235.1.46141 WP_003412235.1.46150 WP_003412235.1.46201 WP_003412235.1.46226 WP_003412235.1.4624 WP_003412235.1.46253 WP_003412235.1.46268 WP_003412235.1.46285 WP_003412235.1.46300 WP_003412235.1.46313 WP_003412235.1.46336 WP_003412235.1.46365 WP_003412235.1.46370 WP_003412235.1.46381 WP_003412235.1.46402 WP_003412235.1.46411 WP_003412235.1.4644 WP_003412235.1.46442 WP_003412235.1.46453 WP_003412235.1.46463 WP_003412235.1.46478 WP_003412235.1.46492 WP_003412235.1.46521 WP_003412235.1.4653 WP_003412235.1.46532 WP_003412235.1.46539 WP_003412235.1.46568 WP_003412235.1.46585 WP_003412235.1.46609 WP_003412235.1.46613 WP_003412235.1.46625 WP_003412235.1.46642 WP_003412235.1.46647 WP_003412235.1.46674 WP_003412235.1.46724 WP_003412235.1.46758 WP_003412235.1.46773 WP_003412235.1.46777 WP_003412235.1.46786 WP_003412235.1.46792 WP_003412235.1.46847 WP_003412235.1.4687 WP_003412235.1.46897 WP_003412235.1.46980 WP_003412235.1.47011 WP_003412235.1.47012 WP_003412235.1.47066 WP_003412235.1.47077 WP_003412235.1.47083 WP_003412235.1.47106 WP_003412235.1.47142 WP_003412235.1.47147 WP_003412235.1.47166 WP_003412235.1.47178 WP_003412235.1.47179 WP_003412235.1.47194 WP_003412235.1.47207 WP_003412235.1.47210 WP_003412235.1.47261 WP_003412235.1.47262 WP_003412235.1.47402 WP_003412235.1.47423 WP_003412235.1.47467 WP_003412235.1.47502 WP_003412235.1.4751 WP_003412235.1.47511 WP_003412235.1.47537 WP_003412235.1.47540 WP_003412235.1.47568 WP_003412235.1.47572 WP_003412235.1.47636 WP_003412235.1.4764 WP_003412235.1.47653 WP_003412235.1.47679 WP_003412235.1.47681 WP_003412235.1.47690 WP_003412235.1.4771 WP_003412235.1.47717 WP_003412235.1.47743 WP_003412235.1.47754 WP_003412235.1.47773 WP_003412235.1.47776 WP_003412235.1.47780 WP_003412235.1.47805 WP_003412235.1.47832 WP_003412235.1.47847 WP_003412235.1.47861 WP_003412235.1.47868 WP_003412235.1.47893 WP_003412235.1.47899 WP_003412235.1.479 WP_003412235.1.47912 WP_003412235.1.47913 WP_003412235.1.47926 WP_003412235.1.4794 WP_003412235.1.47943 WP_003412235.1.47944 WP_003412235.1.47959 WP_003412235.1.47974 WP_003412235.1.47993 WP_003412235.1.48039 WP_003412235.1.48050 WP_003412235.1.48084 WP_003412235.1.48097 WP_003412235.1.48101 WP_003412235.1.48109 WP_003412235.1.4813 WP_003412235.1.48130 WP_003412235.1.48135 WP_003412235.1.48143 WP_003412235.1.48152 WP_003412235.1.48155 WP_003412235.1.48170 WP_003412235.1.48173 WP_003412235.1.48177 WP_003412235.1.48185 WP_003412235.1.48204 WP_003412235.1.48219 WP_003412235.1.4823 WP_003412235.1.48240 WP_003412235.1.48256 WP_003412235.1.48264 WP_003412235.1.48287 WP_003412235.1.48330 WP_003412235.1.48333 WP_003412235.1.48348 WP_003412235.1.48354 WP_003412235.1.48372 WP_003412235.1.48383 WP_003412235.1.48388 WP_003412235.1.48419 WP_003412235.1.48423 WP_003412235.1.48443 WP_003412235.1.48450 WP_003412235.1.48462 WP_003412235.1.48543 WP_003412235.1.48550 WP_003412235.1.48618 WP_003412235.1.4863 WP_003412235.1.48648 WP_003412235.1.48658 WP_003412235.1.48666 WP_003412235.1.48687 WP_003412235.1.4878 WP_003412235.1.48798 WP_003412235.1.48826 WP_003412235.1.48831 WP_003412235.1.48843 WP_003412235.1.48857 WP_003412235.1.4890 WP_003412235.1.48946 WP_003412235.1.48979 WP_003412235.1.49017 WP_003412235.1.49048 WP_003412235.1.49059 WP_003412235.1.4906 WP_003412235.1.4907 WP_003412235.1.49103 WP_003412235.1.49110 WP_003412235.1.49111 WP_003412235.1.49112 WP_003412235.1.4919 WP_003412235.1.49251 WP_003412235.1.49263 WP_003412235.1.49291 WP_003412235.1.49296 WP_003412235.1.49335 WP_003412235.1.49337 WP_003412235.1.49419 WP_003412235.1.49426 WP_003412235.1.49437 WP_003412235.1.49439 WP_003412235.1.49474 WP_003412235.1.49506 WP_003412235.1.49516 WP_003412235.1.49523 WP_003412235.1.49526 WP_003412235.1.49532 WP_003412235.1.49588 WP_003412235.1.4959 WP_003412235.1.49678 WP_003412235.1.49687 WP_003412235.1.49699 WP_003412235.1.49709 WP_003412235.1.4971 WP_003412235.1.4972 WP_003412235.1.49736 WP_003412235.1.49746 WP_003412235.1.49764 WP_003412235.1.49773 WP_003412235.1.49796 WP_003412235.1.49814 WP_003412235.1.49815 WP_003412235.1.49816 WP_003412235.1.49839 WP_003412235.1.49857 WP_003412235.1.49878 WP_003412235.1.49880 WP_003412235.1.49944 WP_003412235.1.4999 WP_003412235.1.49990 WP_003412235.1.50068 WP_003412235.1.50077 WP_003412235.1.5008 WP_003412235.1.50081 WP_003412235.1.50122 WP_003412235.1.50126 WP_003412235.1.50149 WP_003412235.1.50162 WP_003412235.1.5018 WP_003412235.1.50194 WP_003412235.1.50218 WP_003412235.1.50235 WP_003412235.1.50249 WP_003412235.1.50265 WP_003412235.1.50271 WP_003412235.1.50324 WP_003412235.1.50347 WP_003412235.1.50372 WP_003412235.1.50398 WP_003412235.1.50407 WP_003412235.1.50444 WP_003412235.1.50466 WP_003412235.1.50472 WP_003412235.1.5048 WP_003412235.1.50498 WP_003412235.1.5050 WP_003412235.1.50540 WP_003412235.1.50554 WP_003412235.1.50557 WP_003412235.1.50601 WP_003412235.1.50610 WP_003412235.1.50632 WP_003412235.1.50633 WP_003412235.1.50642 WP_003412235.1.50655 WP_003412235.1.50659 WP_003412235.1.50683 WP_003412235.1.50689 WP_003412235.1.50692 WP_003412235.1.50714 WP_003412235.1.50729 WP_003412235.1.50756 WP_003412235.1.50784 WP_003412235.1.50794 WP_003412235.1.50841 WP_003412235.1.50860 WP_003412235.1.50868 WP_003412235.1.50877 WP_003412235.1.5096 WP_003412235.1.50981 WP_003412235.1.50987 WP_003412235.1.51003 WP_003412235.1.51009 WP_003412235.1.51037 WP_003412235.1.51074 WP_003412235.1.51082 WP_003412235.1.51101 WP_003412235.1.51116 WP_003412235.1.51149 WP_003412235.1.51157 WP_003412235.1.51213 WP_003412235.1.51232 WP_003412235.1.51239 WP_003412235.1.51247 WP_003412235.1.51266 WP_003412235.1.51279 WP_003412235.1.51291 WP_003412235.1.51294 WP_003412235.1.51301 WP_003412235.1.51329 WP_003412235.1.51391 WP_003412235.1.51422 WP_003412235.1.51445 WP_003412235.1.51455 WP_003412235.1.51466 WP_003412235.1.51478 WP_003412235.1.51497 WP_003412235.1.51520 WP_003412235.1.51593 WP_003412235.1.51628 WP_003412235.1.5164 WP_003412235.1.51647 WP_003412235.1.51660 WP_003412235.1.51696 WP_003412235.1.51721 WP_003412235.1.51788 WP_003412235.1.51795 WP_003412235.1.51801 WP_003412235.1.51817 WP_003412235.1.51819 WP_003412235.1.51854 WP_003412235.1.51923 WP_003412235.1.51942 WP_003412235.1.51948 WP_003412235.1.51963 WP_003412235.1.51969 WP_003412235.1.52000 WP_003412235.1.52003 WP_003412235.1.52006 WP_003412235.1.52036 WP_003412235.1.52038 WP_003412235.1.52046 WP_003412235.1.52059 WP_003412235.1.52069 WP_003412235.1.52082 WP_003412235.1.52102 WP_003412235.1.52106 WP_003412235.1.52166 WP_003412235.1.52168 WP_003412235.1.52173 WP_003412235.1.52178 WP_003412235.1.52206 WP_003412235.1.52216 WP_003412235.1.52238 WP_003412235.1.52241 WP_003412235.1.52280 WP_003412235.1.52314 WP_003412235.1.52385 WP_003412235.1.52390 WP_003412235.1.524 WP_003412235.1.52460 WP_003412235.1.52485 WP_003412235.1.52486 WP_003412235.1.52495 WP_003412235.1.52504 WP_003412235.1.52522 WP_003412235.1.52531 WP_003412235.1.52533 WP_003412235.1.52545 WP_003412235.1.52553 WP_003412235.1.52563 WP_003412235.1.52564 WP_003412235.1.52574 WP_003412235.1.52641 WP_003412235.1.52673 WP_003412235.1.52674 WP_003412235.1.52708 WP_003412235.1.52713 WP_003412235.1.52761 WP_003412235.1.52778 WP_003412235.1.52791 WP_003412235.1.52797 WP_003412235.1.52872 WP_003412235.1.52873 WP_003412235.1.52891 WP_003412235.1.52892 WP_003412235.1.52909 WP_003412235.1.52970 WP_003412235.1.52998 WP_003412235.1.53053 WP_003412235.1.53056 WP_003412235.1.5306 WP_003412235.1.53088 WP_003412235.1.5309 WP_003412235.1.531 WP_003412235.1.53117 WP_003412235.1.53118 WP_003412235.1.53142 WP_003412235.1.53143 WP_003412235.1.53157 WP_003412235.1.53167 WP_003412235.1.53204 WP_003412235.1.53213 WP_003412235.1.53217 WP_003412235.1.53226 WP_003412235.1.53229 WP_003412235.1.53230 WP_003412235.1.53237 WP_003412235.1.53254 WP_003412235.1.53257 WP_003412235.1.5327 WP_003412235.1.53276 WP_003412235.1.53278 WP_003412235.1.533 WP_003412235.1.53302 WP_003412235.1.5334 WP_003412235.1.5335 WP_003412235.1.53353 WP_003412235.1.53381 WP_003412235.1.53413 WP_003412235.1.53458 WP_003412235.1.53460 WP_003412235.1.53480 WP_003412235.1.53517 WP_003412235.1.53522 WP_003412235.1.53525 WP_003412235.1.53526 WP_003412235.1.53553 WP_003412235.1.53606 WP_003412235.1.53609 WP_003412235.1.53628 WP_003412235.1.53643 WP_003412235.1.53667 WP_003412235.1.53679 WP_003412235.1.53730 WP_003412235.1.53742 WP_003412235.1.53743 WP_003412235.1.53754 WP_003412235.1.53775 WP_003412235.1.53787 WP_003412235.1.53803 WP_003412235.1.53818 WP_003412235.1.53822 WP_003412235.1.53853 WP_003412235.1.53865 WP_003412235.1.53888 WP_003412235.1.53900 WP_003412235.1.53912 WP_003412235.1.53914 WP_003412235.1.53952 WP_003412235.1.5398 WP_003412235.1.5408 WP_003412235.1.54089 WP_003412235.1.54093 WP_003412235.1.54112 WP_003412235.1.54125 WP_003412235.1.54141 WP_003412235.1.54162 WP_003412235.1.54179 WP_003412235.1.54206 WP_003412235.1.54218 WP_003412235.1.54225 WP_003412235.1.54227 WP_003412235.1.54232 WP_003412235.1.54241 WP_003412235.1.54245 WP_003412235.1.54247 WP_003412235.1.54260 WP_003412235.1.54275 WP_003412235.1.54280 WP_003412235.1.54294 WP_003412235.1.54314 WP_003412235.1.54351 WP_003412235.1.54370 WP_003412235.1.54428 WP_003412235.1.54449 WP_003412235.1.54494 WP_003412235.1.54502 WP_003412235.1.54514 WP_003412235.1.54519 WP_003412235.1.5452 WP_003412235.1.54531 WP_003412235.1.54537 WP_003412235.1.54553 WP_003412235.1.54555 WP_003412235.1.54575 WP_003412235.1.54633 WP_003412235.1.54686 WP_003412235.1.54687 WP_003412235.1.54705 WP_003412235.1.54730 WP_003412235.1.54732 WP_003412235.1.5475 WP_003412235.1.54797 WP_003412235.1.54807 WP_003412235.1.54836 WP_003412235.1.54838 WP_003412235.1.54860 WP_003412235.1.54888 WP_003412235.1.54897 WP_003412235.1.54905 WP_003412235.1.54909 WP_003412235.1.54937 WP_003412235.1.54939 WP_003412235.1.54944 WP_003412235.1.54945 WP_003412235.1.54953 WP_003412235.1.54964 WP_003412235.1.55015 WP_003412235.1.55022 WP_003412235.1.55023 WP_003412235.1.55051 WP_003412235.1.55072 WP_003412235.1.55088 WP_003412235.1.55106 WP_003412235.1.55126 WP_003412235.1.55128 WP_003412235.1.55140 WP_003412235.1.55150 WP_003412235.1.55210 WP_003412235.1.55227 WP_003412235.1.55248 WP_003412235.1.55257 WP_003412235.1.55258 WP_003412235.1.55267 WP_003412235.1.55279 WP_003412235.1.55307 WP_003412235.1.55326 WP_003412235.1.55328 WP_003412235.1.5533 WP_003412235.1.55345 WP_003412235.1.55396 WP_003412235.1.55398 WP_003412235.1.55459 WP_003412235.1.55504 WP_003412235.1.55578 WP_003412235.1.55626 WP_003412235.1.55641 WP_003412235.1.5569 WP_003412235.1.55723 WP_003412235.1.55735 WP_003412235.1.5574 WP_003412235.1.55772 WP_003412235.1.55802 WP_003412235.1.55807 WP_003412235.1.55819 WP_003412235.1.55821 WP_003412235.1.5583 WP_003412235.1.55849 WP_003412235.1.55856 WP_003412235.1.55860 WP_003412235.1.55882 WP_003412235.1.55883 WP_003412235.1.55894 WP_003412235.1.55902 WP_003412235.1.55909 WP_003412235.1.5591 WP_003412235.1.55961 WP_003412235.1.55977 WP_003412235.1.56028 WP_003412235.1.56057 WP_003412235.1.56060 WP_003412235.1.56107 WP_003412235.1.56163 WP_003412235.1.56167 WP_003412235.1.56178 WP_003412235.1.56287 WP_003412235.1.56292 WP_003412235.1.56327 WP_003412235.1.56341 WP_003412235.1.56359 WP_003412235.1.56365 WP_003412235.1.56394 WP_003412235.1.56443 WP_003412235.1.56473 WP_003412235.1.56478 WP_003412235.1.56500 WP_003412235.1.56517 WP_003412235.1.56534 WP_003412235.1.5656 WP_003412235.1.56577 WP_003412235.1.56593 WP_003412235.1.56625 WP_003412235.1.56637 WP_003412235.1.56670 WP_003412235.1.56697 WP_003412235.1.567 WP_003412235.1.56701 WP_003412235.1.56709 WP_003412235.1.56729 WP_003412235.1.56743 WP_003412235.1.56755 WP_003412235.1.56764 WP_003412235.1.56769 WP_003412235.1.56770 WP_003412235.1.56795 WP_003412235.1.5681 WP_003412235.1.56827 WP_003412235.1.56839 WP_003412235.1.56863 WP_003412235.1.56868 WP_003412235.1.56869 WP_003412235.1.56915 WP_003412235.1.56926 WP_003412235.1.56961 WP_003412235.1.56971 WP_003412235.1.56972 WP_003412235.1.57023 WP_003412235.1.57077 WP_003412235.1.57087 WP_003412235.1.57094 WP_003412235.1.57134 WP_003412235.1.57151 WP_003412235.1.57169 WP_003412235.1.57208 WP_003412235.1.57212 WP_003412235.1.57230 WP_003412235.1.5724 WP_003412235.1.5725 WP_003412235.1.5727 WP_003412235.1.57273 WP_003412235.1.573 WP_003412235.1.57314 WP_003412235.1.57326 WP_003412235.1.57328 WP_003412235.1.57331 WP_003412235.1.57340 WP_003412235.1.57351 WP_003412235.1.57352 WP_003412235.1.57380 WP_003412235.1.57430 WP_003412235.1.5744 WP_003412235.1.57440 WP_003412235.1.5745 WP_003412235.1.57461 WP_003412235.1.57469 WP_003412235.1.57489 WP_003412235.1.575 WP_003412235.1.57509 WP_003412235.1.57519 WP_003412235.1.57525 WP_003412235.1.57551 WP_003412235.1.5758 WP_003412235.1.57604 WP_003412235.1.57616 WP_003412235.1.57617 WP_003412235.1.57619 WP_003412235.1.57627 WP_003412235.1.57642 WP_003412235.1.57658 WP_003412235.1.57667 WP_003412235.1.57675 WP_003412235.1.57689 WP_003412235.1.57708 WP_003412235.1.57794 WP_003412235.1.57821 WP_003412235.1.57825 WP_003412235.1.57843 WP_003412235.1.57906 WP_003412235.1.57924 WP_003412235.1.57926 WP_003412235.1.57930 WP_003412235.1.57957 WP_003412235.1.57960 WP_003412235.1.57991 WP_003412235.1.58000 WP_003412235.1.58086 WP_003412235.1.58101 WP_003412235.1.58103 WP_003412235.1.58108 WP_003412235.1.5811 WP_003412235.1.58121 WP_003412235.1.58145 WP_003412235.1.58164 WP_003412235.1.58174 WP_003412235.1.582 WP_003412235.1.58202 WP_003412235.1.58209 WP_003412235.1.58215 WP_003412235.1.5824 WP_003412235.1.58250 WP_003412235.1.58259 WP_003412235.1.58283 WP_003412235.1.58288 WP_003412235.1.5830 WP_003412235.1.58303 WP_003412235.1.58311 WP_003412235.1.58330 WP_003412235.1.58359 WP_003412235.1.58386 WP_003412235.1.58393 WP_003412235.1.58431 WP_003412235.1.5844 WP_003412235.1.58457 WP_003412235.1.58488 WP_003412235.1.58518 WP_003412235.1.58534 WP_003412235.1.58559 WP_003412235.1.58567 WP_003412235.1.58573 WP_003412235.1.58602 WP_003412235.1.58612 WP_003412235.1.58619 WP_003412235.1.58630 WP_003412235.1.5865 WP_003412235.1.58671 WP_003412235.1.58690 WP_003412235.1.58702 WP_003412235.1.58743 WP_003412235.1.5879 WP_003412235.1.5881 WP_003412235.1.58824 WP_003412235.1.58848 WP_003412235.1.58857 WP_003412235.1.58891 WP_003412235.1.58892 WP_003412235.1.5890 WP_003412235.1.58904 WP_003412235.1.58921 WP_003412235.1.58930 WP_003412235.1.58939 WP_003412235.1.58941 WP_003412235.1.58953 WP_003412235.1.58961 WP_003412235.1.5898 WP_003412235.1.59025 WP_003412235.1.59029 WP_003412235.1.59037 WP_003412235.1.59044 WP_003412235.1.59085 WP_003412235.1.59088 WP_003412235.1.59130 WP_003412235.1.5914 WP_003412235.1.59147 WP_003412235.1.59166 WP_003412235.1.59205 WP_003412235.1.59209 WP_003412235.1.59237 WP_003412235.1.59240 WP_003412235.1.59253 WP_003412235.1.59254 WP_003412235.1.59262 WP_003412235.1.59270 WP_003412235.1.5928 WP_003412235.1.59304 WP_003412235.1.59305 WP_003412235.1.59309 WP_003412235.1.59316 WP_003412235.1.59326 WP_003412235.1.59328 WP_003412235.1.59333 WP_003412235.1.59338 WP_003412235.1.59388 WP_003412235.1.59428 WP_003412235.1.59487 WP_003412235.1.59537 WP_003412235.1.59561 WP_003412235.1.59677 WP_003412235.1.59722 WP_003412235.1.59727 WP_003412235.1.59732 WP_003412235.1.59738 WP_003412235.1.59750 WP_003412235.1.59757 WP_003412235.1.59761 WP_003412235.1.59808 WP_003412235.1.59850 WP_003412235.1.59856 WP_003412235.1.59860 WP_003412235.1.59861 WP_003412235.1.5987 WP_003412235.1.59878 WP_003412235.1.59952 WP_003412235.1.5996 WP_003412235.1.59961 WP_003412235.1.59974 WP_003412235.1.6000 WP_003412235.1.60007 WP_003412235.1.60016 WP_003412235.1.6003 WP_003412235.1.60047 WP_003412235.1.6007 WP_003412235.1.60091 WP_003412235.1.60121 WP_003412235.1.60135 WP_003412235.1.60139 WP_003412235.1.60152 WP_003412235.1.60171 WP_003412235.1.60197 WP_003412235.1.6020 WP_003412235.1.60205 WP_003412235.1.60207 WP_003412235.1.60215 WP_003412235.1.60217 WP_003412235.1.60267 WP_003412235.1.60288 WP_003412235.1.60291 WP_003412235.1.60301 WP_003412235.1.60305 WP_003412235.1.60312 WP_003412235.1.60313 WP_003412235.1.60314 WP_003412235.1.60367 WP_003412235.1.60376 WP_003412235.1.60403 WP_003412235.1.60413 WP_003412235.1.60421 WP_003412235.1.60451 WP_003412235.1.60460 WP_003412235.1.60479 WP_003412235.1.60487 WP_003412235.1.60512 WP_003412235.1.60573 WP_003412235.1.60583 WP_003412235.1.60632 WP_003412235.1.60657 WP_003412235.1.60687 WP_003412235.1.60689 WP_003412235.1.60727 WP_003412235.1.60738 WP_003412235.1.60763 WP_003412235.1.6077 WP_003412235.1.60791 WP_003412235.1.60834 WP_003412235.1.60870 WP_003412235.1.60878 WP_003412235.1.60879 WP_003412235.1.60978 WP_003412235.1.61000 WP_003412235.1.61001 WP_003412235.1.61012 WP_003412235.1.61014 WP_003412235.1.61015 WP_003412235.1.61037 WP_003412235.1.61052 WP_003412235.1.61065 WP_003412235.1.61100 WP_003412235.1.61138 WP_003412235.1.61142 WP_003412235.1.612 WP_003412235.1.61234 WP_003412235.1.61256 WP_003412235.1.61281 WP_003412235.1.61314 WP_003412235.1.61321 WP_003412235.1.61326 WP_003412235.1.61328 WP_003412235.1.61368 WP_003412235.1.61391 WP_003412235.1.61406 WP_003412235.1.61409 WP_003412235.1.61420 WP_003412235.1.61422 WP_003412235.1.61425 WP_003412235.1.61428 WP_003412235.1.61469 WP_003412235.1.61494 WP_003412235.1.61522 WP_003412235.1.61552 WP_003412235.1.61557 WP_003412235.1.61567 WP_003412235.1.61571 WP_003412235.1.61573 WP_003412235.1.61584 WP_003412235.1.61586 WP_003412235.1.6159 WP_003412235.1.61592 WP_003412235.1.6160 WP_003412235.1.61614 WP_003412235.1.6163 WP_003412235.1.61655 WP_003412235.1.61665 WP_003412235.1.61669 WP_003412235.1.61682 WP_003412235.1.61692 WP_003412235.1.61719 WP_003412235.1.61728 WP_003412235.1.61750 WP_003412235.1.61754 WP_003412235.1.61755 WP_003412235.1.61757 WP_003412235.1.61778 WP_003412235.1.6179 WP_003412235.1.61793 WP_003412235.1.61816 WP_003412235.1.61842 WP_003412235.1.61850 WP_003412235.1.61862 WP_003412235.1.61865 WP_003412235.1.61868 WP_003412235.1.61911 WP_003412235.1.61925 WP_003412235.1.61941 WP_003412235.1.61979 WP_003412235.1.61986 WP_003412235.1.61987 WP_003412235.1.61998 WP_003412235.1.62021 WP_003412235.1.62087 WP_003412235.1.62089 WP_003412235.1.62101 WP_003412235.1.62104 WP_003412235.1.6211 WP_003412235.1.62132 WP_003412235.1.62162 WP_003412235.1.62225 WP_003412235.1.62230 WP_003412235.1.62238 WP_003412235.1.62249 WP_003412235.1.62270 WP_003412235.1.62281 WP_003412235.1.62307 WP_003412235.1.6231 WP_003412235.1.62359 WP_003412235.1.62360 WP_003412235.1.62371 WP_003412235.1.62379 WP_003412235.1.62395 WP_003412235.1.62408 WP_003412235.1.62449 WP_003412235.1.62468 WP_003412235.1.6248 WP_003412235.1.62508 WP_003412235.1.62594 WP_003412235.1.62606 WP_003412235.1.62616 WP_003412235.1.62666 WP_003412235.1.62687 WP_003412235.1.62715 WP_003412235.1.62730 WP_003412235.1.62738 WP_003412235.1.62761 WP_003412235.1.62766 WP_003412235.1.62786 WP_003412235.1.62813 WP_003412235.1.62839 WP_003412235.1.62841 WP_003412235.1.62909 WP_003412235.1.62936 WP_003412235.1.6294 WP_003412235.1.6295 WP_003412235.1.62962 WP_003412235.1.63019 WP_003412235.1.63032 WP_003412235.1.63037 WP_003412235.1.63064 WP_003412235.1.63066 WP_003412235.1.63072 WP_003412235.1.6308 WP_003412235.1.63081 WP_003412235.1.63096 WP_003412235.1.63106 WP_003412235.1.6314 WP_003412235.1.63144 WP_003412235.1.63154 WP_003412235.1.63160 WP_003412235.1.63161 WP_003412235.1.63166 WP_003412235.1.63175 WP_003412235.1.63194 WP_003412235.1.6322 WP_003412235.1.63222 WP_003412235.1.63247 WP_003412235.1.6328 WP_003412235.1.63291 WP_003412235.1.63312 WP_003412235.1.63317 WP_003412235.1.63331 WP_003412235.1.63373 WP_003412235.1.63384 WP_003412235.1.63403 WP_003412235.1.63424 WP_003412235.1.63428 WP_003412235.1.6345 WP_003412235.1.63464 WP_003412235.1.63483 WP_003412235.1.63502 WP_003412235.1.63504 WP_003412235.1.63522 WP_003412235.1.63530 WP_003412235.1.63538 WP_003412235.1.63564 WP_003412235.1.63567 WP_003412235.1.63596 WP_003412235.1.63600 WP_003412235.1.63623 WP_003412235.1.63624 WP_003412235.1.63625 WP_003412235.1.63627 WP_003412235.1.63654 WP_003412235.1.63662 WP_003412235.1.63711 WP_003412235.1.63734 WP_003412235.1.63807 WP_003412235.1.63819 WP_003412235.1.63844 WP_003412235.1.63888 WP_003412235.1.63913 WP_003412235.1.63918 WP_003412235.1.63961 WP_003412235.1.63970 WP_003412235.1.64000 WP_003412235.1.64027 WP_003412235.1.64058 WP_003412235.1.64065 WP_003412235.1.6407 WP_003412235.1.64082 WP_003412235.1.64091 WP_003412235.1.64102 WP_003412235.1.64104 WP_003412235.1.64119 WP_003412235.1.64169 WP_003412235.1.64219 WP_003412235.1.6422 WP_003412235.1.64222 WP_003412235.1.64223 WP_003412235.1.64228 WP_003412235.1.64235 WP_003412235.1.64249 WP_003412235.1.6427 WP_003412235.1.64278 WP_003412235.1.64287 WP_003412235.1.64414 WP_003412235.1.64419 WP_003412235.1.6443 WP_003412235.1.64463 WP_003412235.1.64480 WP_003412235.1.64497 WP_003412235.1.64506 WP_003412235.1.64511 WP_003412235.1.64513 WP_003412235.1.64514 WP_003412235.1.64515 WP_003412235.1.64522 WP_003412235.1.64526 WP_003412235.1.64543 WP_003412235.1.64567 WP_003412235.1.64588 WP_003412235.1.64589 WP_003412235.1.64594 WP_003412235.1.64595 WP_003412235.1.64608 WP_003412235.1.64619 WP_003412235.1.64629 WP_003412235.1.6464 WP_003412235.1.64664 WP_003412235.1.64669 WP_003412235.1.64672 WP_003412235.1.64680 WP_003412235.1.64682 WP_003412235.1.64727 WP_003412235.1.64729 WP_003412235.1.64776 WP_003412235.1.64802 WP_003412235.1.64832 WP_003412235.1.6486 WP_003412235.1.64870 WP_003412235.1.64898 WP_003412235.1.64922 WP_003412235.1.64924 WP_003412235.1.6493 WP_003412235.1.64937 WP_003412235.1.64941 WP_003412235.1.64966 WP_003412235.1.64973 WP_003412235.1.65001 WP_003412235.1.65026 WP_003412235.1.65053 WP_003412235.1.65070 WP_003412235.1.65079 WP_003412235.1.65102 WP_003412235.1.65157 WP_003412235.1.65181 WP_003412235.1.65212 WP_003412235.1.65229 WP_003412235.1.6523 WP_003412235.1.65253 WP_003412235.1.65289 WP_003412235.1.65291 WP_003412235.1.65315 WP_003412235.1.65329 WP_003412235.1.65359 WP_003412235.1.6536 WP_003412235.1.65374 WP_003412235.1.65414 WP_003412235.1.65416 WP_003412235.1.65433 WP_003412235.1.65455 WP_003412235.1.65467 WP_003412235.1.65488 WP_003412235.1.65529 WP_003412235.1.65539 WP_003412235.1.65583 WP_003412235.1.65612 WP_003412235.1.65623 WP_003412235.1.65635 WP_003412235.1.65637 WP_003412235.1.65648 WP_003412235.1.65683 WP_003412235.1.65686 WP_003412235.1.65688 WP_003412235.1.65707 WP_003412235.1.65733 WP_003412235.1.65746 WP_003412235.1.65747 WP_003412235.1.65759 WP_003412235.1.65830 WP_003412235.1.65858 WP_003412235.1.65862 WP_003412235.1.65869 WP_003412235.1.65893 WP_003412235.1.65929 WP_003412235.1.65932 WP_003412235.1.65958 WP_003412235.1.66004 WP_003412235.1.66013 WP_003412235.1.6606 WP_003412235.1.66089 WP_003412235.1.66149 WP_003412235.1.66151 WP_003412235.1.66229 WP_003412235.1.66276 WP_003412235.1.66293 WP_003412235.1.66297 WP_003412235.1.66323 WP_003412235.1.66325 WP_003412235.1.6633 WP_003412235.1.66334 WP_003412235.1.66355 WP_003412235.1.66367 WP_003412235.1.66394 WP_003412235.1.66396 WP_003412235.1.66451 WP_003412235.1.66455 WP_003412235.1.66457 WP_003412235.1.66460 WP_003412235.1.66464 WP_003412235.1.66487 WP_003412235.1.66504 WP_003412235.1.66544 WP_003412235.1.66558 WP_003412235.1.66580 WP_003412235.1.66582 WP_003412235.1.66612 WP_003412235.1.66615 WP_003412235.1.66617 WP_003412235.1.66635 WP_003412235.1.66656 WP_003412235.1.66663 WP_003412235.1.66675 WP_003412235.1.66715 WP_003412235.1.66718 WP_003412235.1.66762 WP_003412235.1.66776 WP_003412235.1.66808 WP_003412235.1.66817 WP_003412235.1.66819 WP_003412235.1.66826 WP_003412235.1.66830 WP_003412235.1.66842 WP_003412235.1.66878 WP_003412235.1.66880 WP_003412235.1.66893 WP_003412235.1.66961 WP_003412235.1.67005 WP_003412235.1.6704 WP_003412235.1.67044 WP_003412235.1.67061 WP_003412235.1.67089 WP_003412235.1.67098 WP_003412235.1.67146 WP_003412235.1.67170 WP_003412235.1.67197 WP_003412235.1.67198 WP_003412235.1.6720 WP_003412235.1.67207 WP_003412235.1.67218 WP_003412235.1.67220 WP_003412235.1.67225 WP_003412235.1.67231 WP_003412235.1.6724 WP_003412235.1.67257 WP_003412235.1.67298 WP_003412235.1.67307 WP_003412235.1.67324 WP_003412235.1.67332 WP_003412235.1.67346 WP_003412235.1.67354 WP_003412235.1.67360 WP_003412235.1.67381 WP_003412235.1.67396 WP_003412235.1.67417 WP_003412235.1.67422 WP_003412235.1.67453 WP_003412235.1.67459 WP_003412235.1.6746 WP_003412235.1.67473 WP_003412235.1.67481 WP_003412235.1.67482 WP_003412235.1.67496 WP_003412235.1.67499 WP_003412235.1.67516 WP_003412235.1.67536 WP_003412235.1.67575 WP_003412235.1.67587 WP_003412235.1.67598 WP_003412235.1.67600 WP_003412235.1.67602 WP_003412235.1.67630 WP_003412235.1.67679 WP_003412235.1.67692 WP_003412235.1.67744 WP_003412235.1.6775 WP_003412235.1.67750 WP_003412235.1.6777 WP_003412235.1.67809 WP_003412235.1.67816 WP_003412235.1.67844 WP_003412235.1.67848 WP_003412235.1.67870 WP_003412235.1.67888 WP_003412235.1.67915 WP_003412235.1.67945 WP_003412235.1.67949 WP_003412235.1.67980 WP_003412235.1.67982 WP_003412235.1.68022 WP_003412235.1.68029 WP_003412235.1.68037 WP_003412235.1.68038 WP_003412235.1.68045 WP_003412235.1.68057 WP_003412235.1.68083 WP_003412235.1.68088 WP_003412235.1.68106 WP_003412235.1.68110 WP_003412235.1.68153 WP_003412235.1.68164 WP_003412235.1.68169 WP_003412235.1.68193 WP_003412235.1.68212 WP_003412235.1.68227 WP_003412235.1.68243 WP_003412235.1.6825 WP_003412235.1.68297 WP_003412235.1.68309 WP_003412235.1.68325 WP_003412235.1.68329 WP_003412235.1.68340 WP_003412235.1.68384 WP_003412235.1.68388 WP_003412235.1.68429 WP_003412235.1.6843 WP_003412235.1.68433 WP_003412235.1.68444 WP_003412235.1.68465 WP_003412235.1.68484 WP_003412235.1.68569 WP_003412235.1.68576 WP_003412235.1.68580 WP_003412235.1.68586 WP_003412235.1.68623 WP_003412235.1.68624 WP_003412235.1.68637 WP_003412235.1.68646 WP_003412235.1.68669 WP_003412235.1.68672 WP_003412235.1.68684 WP_003412235.1.68704 WP_003412235.1.68708 WP_003412235.1.6872 WP_003412235.1.68734 WP_003412235.1.68754 WP_003412235.1.6876 WP_003412235.1.68761 WP_003412235.1.68763 WP_003412235.1.68766 WP_003412235.1.68774 WP_003412235.1.68796 WP_003412235.1.68824 WP_003412235.1.68832 WP_003412235.1.68833 WP_003412235.1.68841 WP_003412235.1.68859 WP_003412235.1.68876 WP_003412235.1.68906 WP_003412235.1.68916 WP_003412235.1.68923 WP_003412235.1.68945 WP_003412235.1.6896 WP_003412235.1.68981 WP_003412235.1.68984 WP_003412235.1.68997 WP_003412235.1.69008 WP_003412235.1.69076 WP_003412235.1.69079 WP_003412235.1.6908 WP_003412235.1.69082 WP_003412235.1.69178 WP_003412235.1.69181 WP_003412235.1.69208 WP_003412235.1.69231 WP_003412235.1.69256 WP_003412235.1.69311 WP_003412235.1.69315 WP_003412235.1.69322 WP_003412235.1.69342 WP_003412235.1.6935 WP_003412235.1.6936 WP_003412235.1.69369 WP_003412235.1.69374 WP_003412235.1.69398 WP_003412235.1.69401 WP_003412235.1.69426 WP_003412235.1.69427 WP_003412235.1.69429 WP_003412235.1.6949 WP_003412235.1.6951 WP_003412235.1.69511 WP_003412235.1.69526 WP_003412235.1.69528 WP_003412235.1.69547 WP_003412235.1.69573 WP_003412235.1.69581 WP_003412235.1.6960 WP_003412235.1.69617 WP_003412235.1.69634 WP_003412235.1.69647 WP_003412235.1.69659 WP_003412235.1.69673 WP_003412235.1.69682 WP_003412235.1.69684 WP_003412235.1.69686 WP_003412235.1.69707 WP_003412235.1.69709 WP_003412235.1.69723 WP_003412235.1.69736 WP_003412235.1.69778 WP_003412235.1.69800 WP_003412235.1.69802 WP_003412235.1.69845 WP_003412235.1.69870 WP_003412235.1.69873 WP_003412235.1.69898 WP_003412235.1.69913 WP_003412235.1.69931 WP_003412235.1.69938 WP_003412235.1.69955 WP_003412235.1.69981 WP_003412235.1.69990 WP_003412235.1.70 WP_003412235.1.70000 WP_003412235.1.70017 WP_003412235.1.70032 WP_003412235.1.70055 WP_003412235.1.70062 WP_003412235.1.70072 WP_003412235.1.70131 WP_003412235.1.70132 WP_003412235.1.7022 WP_003412235.1.70227 WP_003412235.1.70255 WP_003412235.1.70271 WP_003412235.1.70274 WP_003412235.1.7029 WP_003412235.1.70325 WP_003412235.1.70328 WP_003412235.1.70356 WP_003412235.1.70364 WP_003412235.1.70368 WP_003412235.1.70369 WP_003412235.1.70418 WP_003412235.1.70422 WP_003412235.1.70435 WP_003412235.1.70444 WP_003412235.1.70463 WP_003412235.1.70471 WP_003412235.1.70480 WP_003412235.1.70494 WP_003412235.1.70498 WP_003412235.1.70505 WP_003412235.1.70525 WP_003412235.1.70573 WP_003412235.1.70577 WP_003412235.1.70610 WP_003412235.1.70615 WP_003412235.1.70618 WP_003412235.1.70622 WP_003412235.1.70626 WP_003412235.1.70668 WP_003412235.1.70699 WP_003412235.1.70704 WP_003412235.1.70729 WP_003412235.1.70757 WP_003412235.1.70782 WP_003412235.1.70796 WP_003412235.1.70834 WP_003412235.1.7084 WP_003412235.1.70840 WP_003412235.1.70864 WP_003412235.1.70871 WP_003412235.1.70915 WP_003412235.1.70955 WP_003412235.1.70958 WP_003412235.1.70964 WP_003412235.1.70976 WP_003412235.1.71015 WP_003412235.1.71026 WP_003412235.1.71063 WP_003412235.1.71076 WP_003412235.1.71083 WP_003412235.1.7111 WP_003412235.1.71118 WP_003412235.1.71128 WP_003412235.1.7113 WP_003412235.1.71187 WP_003412235.1.71191 WP_003412235.1.71258 WP_003412235.1.71259 WP_003412235.1.71289 WP_003412235.1.71326 WP_003412235.1.71329 WP_003412235.1.71331 WP_003412235.1.71344 WP_003412235.1.71390 WP_003412235.1.71399 WP_003412235.1.71440 WP_003412235.1.71457 WP_003412235.1.7146 WP_003412235.1.71464 WP_003412235.1.71490 WP_003412235.1.71492 WP_003412235.1.71509 WP_003412235.1.71516 WP_003412235.1.71517 WP_003412235.1.71527 WP_003412235.1.71532 WP_003412235.1.71545 WP_003412235.1.71546 WP_003412235.1.71569 WP_003412235.1.71604 WP_003412235.1.71621 WP_003412235.1.71630 WP_003412235.1.71638 WP_003412235.1.71654 WP_003412235.1.71664 WP_003412235.1.71665 WP_003412235.1.71683 WP_003412235.1.71701 WP_003412235.1.71718 WP_003412235.1.71731 WP_003412235.1.71778 WP_003412235.1.71803 WP_003412235.1.71820 WP_003412235.1.71847 WP_003412235.1.7185 WP_003412235.1.71851 WP_003412235.1.71871 WP_003412235.1.71909 WP_003412235.1.71957 WP_003412235.1.72047 WP_003412235.1.72061 WP_003412235.1.72062 WP_003412235.1.72072 WP_003412235.1.72111 WP_003412235.1.72122 WP_003412235.1.72128 WP_003412235.1.7216 WP_003412235.1.72168 WP_003412235.1.72179 WP_003412235.1.72209 WP_003412235.1.72218 WP_003412235.1.72219 WP_003412235.1.72227 WP_003412235.1.7224 WP_003412235.1.72268 WP_003412235.1.72332 WP_003412235.1.72380 WP_003412235.1.72401 WP_003412235.1.72405 WP_003412235.1.72441 WP_003412235.1.72451 WP_003412235.1.72452 WP_003412235.1.72457 WP_003412235.1.72459 WP_003412235.1.72460 WP_003412235.1.72466 WP_003412235.1.72487 WP_003412235.1.72488 WP_003412235.1.72492 WP_003412235.1.72506 WP_003412235.1.72543 WP_003412235.1.7256 WP_003412235.1.72576 WP_003412235.1.72578 WP_003412235.1.72585 WP_003412235.1.72591 WP_003412235.1.72592 WP_003412235.1.72640 WP_003412235.1.7266 WP_003412235.1.72661 WP_003412235.1.72684 WP_003412235.1.72739 WP_003412235.1.72744 WP_003412235.1.72755 WP_003412235.1.72759 WP_003412235.1.72792 WP_003412235.1.72826 WP_003412235.1.72831 WP_003412235.1.72852 WP_003412235.1.72853 WP_003412235.1.72879 WP_003412235.1.72880 WP_003412235.1.72938 WP_003412235.1.72954 WP_003412235.1.72957 WP_003412235.1.72959 WP_003412235.1.72973 WP_003412235.1.7298 WP_003412235.1.72982 WP_003412235.1.72988 WP_003412235.1.72993 WP_003412235.1.73006 WP_003412235.1.73013 WP_003412235.1.73025 WP_003412235.1.73028 WP_003412235.1.73042 WP_003412235.1.73045 WP_003412235.1.73092 WP_003412235.1.73118 WP_003412235.1.7312 WP_003412235.1.73127 WP_003412235.1.73134 WP_003412235.1.73150 WP_003412235.1.73154 WP_003412235.1.73163 WP_003412235.1.73182 WP_003412235.1.73205 WP_003412235.1.7321 WP_003412235.1.73310 WP_003412235.1.73315 WP_003412235.1.73365 WP_003412235.1.73404 WP_003412235.1.73424 WP_003412235.1.73436 WP_003412235.1.73445 WP_003412235.1.73453 WP_003412235.1.73466 WP_003412235.1.73470 WP_003412235.1.73471 WP_003412235.1.73478 WP_003412235.1.73482 WP_003412235.1.73507 WP_003412235.1.73532 WP_003412235.1.73550 WP_003412235.1.73564 WP_003412235.1.73623 WP_003412235.1.73629 WP_003412235.1.73644 WP_003412235.1.7366 WP_003412235.1.73661 WP_003412235.1.7368 WP_003412235.1.73688 WP_003412235.1.73723 WP_003412235.1.73744 WP_003412235.1.73750 WP_003412235.1.73760 WP_003412235.1.7379 WP_003412235.1.73813 WP_003412235.1.73840 WP_003412235.1.73876 WP_003412235.1.7389 WP_003412235.1.73986 WP_003412235.1.74016 WP_003412235.1.74039 WP_003412235.1.74083 WP_003412235.1.74101 WP_003412235.1.74107 WP_003412235.1.74120 WP_003412235.1.74129 WP_003412235.1.74144 WP_003412235.1.7417 WP_003412235.1.74190 WP_003412235.1.74210 WP_003412235.1.74259 WP_003412235.1.74262 WP_003412235.1.74269 WP_003412235.1.74282 WP_003412235.1.74291 WP_003412235.1.74296 WP_003412235.1.74304 WP_003412235.1.7432 WP_003412235.1.74347 WP_003412235.1.7436 WP_003412235.1.74382 WP_003412235.1.74395 WP_003412235.1.74400 WP_003412235.1.74401 WP_003412235.1.74432 WP_003412235.1.74442 WP_003412235.1.74477 WP_003412235.1.74487 WP_003412235.1.74499 WP_003412235.1.74504 WP_003412235.1.74511 WP_003412235.1.74523 WP_003412235.1.74525 WP_003412235.1.74551 WP_003412235.1.74555 WP_003412235.1.74628 WP_003412235.1.74641 WP_003412235.1.74653 WP_003412235.1.74660 WP_003412235.1.74683 WP_003412235.1.7469 WP_003412235.1.74725 WP_003412235.1.74760 WP_003412235.1.74786 WP_003412235.1.74809 WP_003412235.1.74820 WP_003412235.1.74870 WP_003412235.1.74881 WP_003412235.1.74888 WP_003412235.1.74952 WP_003412235.1.7496 WP_003412235.1.74988 WP_003412235.1.75043 WP_003412235.1.75045 WP_003412235.1.75055 WP_003412235.1.75078 WP_003412235.1.75081 WP_003412235.1.75120 WP_003412235.1.75188 WP_003412235.1.75200 WP_003412235.1.75202 WP_003412235.1.75234 WP_003412235.1.75239 WP_003412235.1.75250 WP_003412235.1.75263 WP_003412235.1.75281 WP_003412235.1.75342 WP_003412235.1.75376 WP_003412235.1.75395 WP_003412235.1.75441 WP_003412235.1.75510 WP_003412235.1.75598 WP_003412235.1.75635 WP_003412235.1.75645 WP_003412235.1.75665 WP_003412235.1.75671 WP_003412235.1.75741 WP_003412235.1.75749 WP_003412235.1.75772 WP_003412235.1.75774 WP_003412235.1.75811 WP_003412235.1.75833 WP_003412235.1.7585 WP_003412235.1.75868 WP_003412235.1.75878 WP_003412235.1.75927 WP_003412235.1.75946 WP_003412235.1.75968 WP_003412235.1.75974 WP_003412235.1.76007 WP_003412235.1.76016 WP_003412235.1.76032 WP_003412235.1.76037 WP_003412235.1.7604 WP_003412235.1.76045 WP_003412235.1.76052 WP_003412235.1.76058 WP_003412235.1.76064 WP_003412235.1.76110 WP_003412235.1.76126 WP_003412235.1.76133 WP_003412235.1.76138 WP_003412235.1.76157 WP_003412235.1.76172 WP_003412235.1.76177 WP_003412235.1.76183 WP_003412235.1.76239 WP_003412235.1.76272 WP_003412235.1.76277 WP_003412235.1.76280 WP_003412235.1.76281 WP_003412235.1.76291 WP_003412235.1.76297 WP_003412235.1.76360 WP_003412235.1.76379 WP_003412235.1.76403 WP_003412235.1.76413 WP_003412235.1.76414 WP_003412235.1.76427 WP_003412235.1.76436 WP_003412235.1.76442 WP_003412235.1.76456 WP_003412235.1.76521 WP_003412235.1.76533 WP_003412235.1.76616 WP_003412235.1.76625 WP_003412235.1.76629 WP_003412235.1.76635 WP_003412235.1.76638 WP_003412235.1.76640 WP_003412235.1.76644 WP_003412235.1.76677 WP_003412235.1.76678 WP_003412235.1.76679 WP_003412235.1.76734 WP_003412235.1.76744 WP_003412235.1.76750 WP_003412235.1.76754 WP_003412235.1.76757 WP_003412235.1.76781 WP_003412235.1.76818 WP_003412235.1.76824 WP_003412235.1.76835 WP_003412235.1.76873 WP_003412235.1.76881 WP_003412235.1.76888 WP_003412235.1.76900 WP_003412235.1.7691 WP_003412235.1.76954 WP_003412235.1.76955 WP_003412235.1.76963 WP_003412235.1.76976 WP_003412235.1.770 WP_003412235.1.77000 WP_003412235.1.77008 WP_003412235.1.77021 WP_003412235.1.77056 WP_003412235.1.77065 WP_003412235.1.77075 WP_003412235.1.77093 WP_003412235.1.77107 WP_003412235.1.77115 WP_003412235.1.77118 WP_003412235.1.77125 WP_003412235.1.77141 WP_003412235.1.77142 WP_003412235.1.77166 WP_003412235.1.77250 WP_003412235.1.77252 WP_003412235.1.77260 WP_003412235.1.77266 WP_003412235.1.77280 WP_003412235.1.77285 WP_003412235.1.77312 WP_003412235.1.77348 WP_003412235.1.77351 WP_003412235.1.77352 WP_003412235.1.77361 WP_003412235.1.774 WP_003412235.1.7740 WP_003412235.1.77404 WP_003412235.1.77425 WP_003412235.1.77463 WP_003412235.1.77474 WP_003412235.1.7748 WP_003412235.1.77491 WP_003412235.1.77499 WP_003412235.1.77510 WP_003412235.1.77554 WP_003412235.1.77559 WP_003412235.1.77599 WP_003412235.1.77605 WP_003412235.1.7762 WP_003412235.1.77627 WP_003412235.1.77649 WP_003412235.1.77654 WP_003412235.1.7766 WP_003412235.1.77667 WP_003412235.1.77704 WP_003412235.1.77706 WP_003412235.1.7778 WP_003412235.1.77790 WP_003412235.1.77809 WP_003412235.1.77820 WP_003412235.1.77843 WP_003412235.1.77855 WP_003412235.1.77865 WP_003412235.1.77868 WP_003412235.1.77879 WP_003412235.1.77890 WP_003412235.1.77909 WP_003412235.1.77911 WP_003412235.1.77931 WP_003412235.1.77984 WP_003412235.1.78020 WP_003412235.1.78024 WP_003412235.1.78075 WP_003412235.1.78084 WP_003412235.1.78086 WP_003412235.1.7809 WP_003412235.1.78098 WP_003412235.1.78105 WP_003412235.1.78113 WP_003412235.1.78162 WP_003412235.1.7817 WP_003412235.1.78200 WP_003412235.1.78216 WP_003412235.1.78236 WP_003412235.1.78238 WP_003412235.1.78322 WP_003412235.1.78338 WP_003412235.1.7836 WP_003412235.1.78360 WP_003412235.1.78386 WP_003412235.1.78429 WP_003412235.1.7844 WP_003412235.1.78459 WP_003412235.1.78488 WP_003412235.1.7849 WP_003412235.1.78499 WP_003412235.1.785 WP_003412235.1.78516 WP_003412235.1.78524 WP_003412235.1.78526 WP_003412235.1.78538 WP_003412235.1.78544 WP_003412235.1.78545 WP_003412235.1.78547 WP_003412235.1.78574 WP_003412235.1.78580 WP_003412235.1.7860 WP_003412235.1.78620 WP_003412235.1.78646 WP_003412235.1.78648 WP_003412235.1.78649 WP_003412235.1.78655 WP_003412235.1.78657 WP_003412235.1.78659 WP_003412235.1.7869 WP_003412235.1.78692 WP_003412235.1.78760 WP_003412235.1.78766 WP_003412235.1.78776 WP_003412235.1.78778 WP_003412235.1.78784 WP_003412235.1.78788 WP_003412235.1.78790 WP_003412235.1.78793 WP_003412235.1.78848 WP_003412235.1.78860 WP_003412235.1.7887 WP_003412235.1.78884 WP_003412235.1.78932 WP_003412235.1.78969 WP_003412235.1.78977 WP_003412235.1.78980 WP_003412235.1.79005 WP_003412235.1.79016 WP_003412235.1.79033 WP_003412235.1.79066 WP_003412235.1.79068 WP_003412235.1.79077 WP_003412235.1.79095 WP_003412235.1.79112 WP_003412235.1.79122 WP_003412235.1.79145 WP_003412235.1.79152 WP_003412235.1.79163 WP_003412235.1.79182 WP_003412235.1.79198 WP_003412235.1.79213 WP_003412235.1.79218 WP_003412235.1.79268 WP_003412235.1.79273 WP_003412235.1.79278 WP_003412235.1.79290 WP_003412235.1.79319 WP_003412235.1.79325 WP_003412235.1.79326 WP_003412235.1.7933 WP_003412235.1.79330 WP_003412235.1.79339 WP_003412235.1.79394 WP_003412235.1.79399 WP_003412235.1.79413 WP_003412235.1.79422 WP_003412235.1.79445 WP_003412235.1.79447 WP_003412235.1.79455 WP_003412235.1.79471 WP_003412235.1.79480 WP_003412235.1.79482 WP_003412235.1.79500 WP_003412235.1.79502 WP_003412235.1.79508 WP_003412235.1.79514 WP_003412235.1.79561 WP_003412235.1.79565 WP_003412235.1.79578 WP_003412235.1.79588 WP_003412235.1.79598 WP_003412235.1.79615 WP_003412235.1.79684 WP_003412235.1.79698 WP_003412235.1.797 WP_003412235.1.79784 WP_003412235.1.79802 WP_003412235.1.79806 WP_003412235.1.79819 WP_003412235.1.79826 WP_003412235.1.79828 WP_003412235.1.79851 WP_003412235.1.79853 WP_003412235.1.79863 WP_003412235.1.79881 WP_003412235.1.79885 WP_003412235.1.79898 WP_003412235.1.7990 WP_003412235.1.79900 WP_003412235.1.79913 WP_003412235.1.79918 WP_003412235.1.79947 WP_003412235.1.79948 WP_003412235.1.7995 WP_003412235.1.7997 WP_003412235.1.80004 WP_003412235.1.80015 WP_003412235.1.80022 WP_003412235.1.80030 WP_003412235.1.80054 WP_003412235.1.80084 WP_003412235.1.80099 WP_003412235.1.80129 WP_003412235.1.80177 WP_003412235.1.8026 WP_003412235.1.80275 WP_003412235.1.8029 WP_003412235.1.80299 WP_003412235.1.80300 WP_003412235.1.80304 WP_003412235.1.80326 WP_003412235.1.8037 WP_003412235.1.80370 WP_003412235.1.80387 WP_003412235.1.80399 WP_003412235.1.8044 WP_003412235.1.80451 WP_003412235.1.80458 WP_003412235.1.80461 WP_003412235.1.80503 WP_003412235.1.80507 WP_003412235.1.80552 WP_003412235.1.80576 WP_003412235.1.80588 WP_003412235.1.80599 WP_003412235.1.8060 WP_003412235.1.80624 WP_003412235.1.80636 WP_003412235.1.80669 WP_003412235.1.80711 WP_003412235.1.80714 WP_003412235.1.80743 WP_003412235.1.80784 WP_003412235.1.80815 WP_003412235.1.80853 WP_003412235.1.80918 WP_003412235.1.8093 WP_003412235.1.80967 WP_003412235.1.8097 WP_003412235.1.80988 WP_003412235.1.81007 WP_003412235.1.81013 WP_003412235.1.8105 WP_003412235.1.81063 WP_003412235.1.81066 WP_003412235.1.81075 WP_003412235.1.81091 WP_003412235.1.81119 WP_003412235.1.81125 WP_003412235.1.8114 WP_003412235.1.81192 WP_003412235.1.812 WP_003412235.1.81230 WP_003412235.1.81249 WP_003412235.1.81250 WP_003412235.1.81264 WP_003412235.1.8128 WP_003412235.1.81287 WP_003412235.1.81297 WP_003412235.1.8138 WP_003412235.1.81407 WP_003412235.1.8143 WP_003412235.1.81439 WP_003412235.1.81465 WP_003412235.1.81505 WP_003412235.1.81529 WP_003412235.1.81538 WP_003412235.1.81541 WP_003412235.1.81560 WP_003412235.1.81561 WP_003412235.1.81567 WP_003412235.1.81583 WP_003412235.1.81686 WP_003412235.1.81712 WP_003412235.1.81720 WP_003412235.1.81731 WP_003412235.1.81774 WP_003412235.1.81788 WP_003412235.1.81809 WP_003412235.1.81820 WP_003412235.1.81850 WP_003412235.1.81883 WP_003412235.1.81918 WP_003412235.1.82011 WP_003412235.1.82048 WP_003412235.1.82069 WP_003412235.1.82071 WP_003412235.1.82108 WP_003412235.1.82136 WP_003412235.1.82142 WP_003412235.1.8215 WP_003412235.1.82158 WP_003412235.1.82209 WP_003412235.1.82210 WP_003412235.1.82228 WP_003412235.1.82236 WP_003412235.1.82251 WP_003412235.1.82271 WP_003412235.1.82305 WP_003412235.1.82307 WP_003412235.1.82309 WP_003412235.1.82317 WP_003412235.1.8232 WP_003412235.1.82346 WP_003412235.1.82374 WP_003412235.1.82385 WP_003412235.1.82429 WP_003412235.1.82460 WP_003412235.1.82462 WP_003412235.1.82483 WP_003412235.1.82494 WP_003412235.1.82531 WP_003412235.1.82546 WP_003412235.1.82547 WP_003412235.1.82577 WP_003412235.1.82592 WP_003412235.1.82597 WP_003412235.1.82598 WP_003412235.1.82625 WP_003412235.1.82642 WP_003412235.1.82651 WP_003412235.1.82653 WP_003412235.1.82681 WP_003412235.1.82685 WP_003412235.1.82712 WP_003412235.1.8273 WP_003412235.1.82743 WP_003412235.1.82757 WP_003412235.1.82774 WP_003412235.1.82836 WP_003412235.1.82860 WP_003412235.1.82871 WP_003412235.1.82892 WP_003412235.1.82935 WP_003412235.1.82957 WP_003412235.1.82981 WP_003412235.1.82983 WP_003412235.1.83004 WP_003412235.1.83009 WP_003412235.1.83044 WP_003412235.1.83065 WP_003412235.1.83074 WP_003412235.1.83110 WP_003412235.1.83146 WP_003412235.1.83149 WP_003412235.1.83159 WP_003412235.1.8317 WP_003412235.1.83173 WP_003412235.1.83181 WP_003412235.1.83182 WP_003412235.1.83191 WP_003412235.1.83197 WP_003412235.1.83212 WP_003412235.1.8326 WP_003412235.1.83262 WP_003412235.1.83268 WP_003412235.1.83273 WP_003412235.1.83309 WP_003412235.1.83332 WP_003412235.1.83334 WP_003412235.1.83341 WP_003412235.1.83349 WP_003412235.1.8335 WP_003412235.1.83353 WP_003412235.1.83367 WP_003412235.1.83380 WP_003412235.1.83381 WP_003412235.1.83389 WP_003412235.1.83408 WP_003412235.1.83409 WP_003412235.1.83435 WP_003412235.1.83470 WP_003412235.1.83524 WP_003412235.1.83526 WP_003412235.1.8358 WP_003412235.1.83589 WP_003412235.1.83601 WP_003412235.1.83611 WP_003412235.1.83638 WP_003412235.1.83648 WP_003412235.1.83656 WP_003412235.1.83667 WP_003412235.1.83689 WP_003412235.1.83692 WP_003412235.1.83704 WP_003412235.1.83705 WP_003412235.1.83766 WP_003412235.1.83793 WP_003412235.1.83794 WP_003412235.1.83802 WP_003412235.1.83805 WP_003412235.1.83839 WP_003412235.1.83842 WP_003412235.1.83850 WP_003412235.1.83884 WP_003412235.1.83920 WP_003412235.1.83929 WP_003412235.1.83930 WP_003412235.1.83975 WP_003412235.1.83991 WP_003412235.1.8400 WP_003412235.1.84027 WP_003412235.1.8404 WP_003412235.1.84057 WP_003412235.1.84070 WP_003412235.1.8409 WP_003412235.1.84112 WP_003412235.1.84146 WP_003412235.1.8415 WP_003412235.1.84176 WP_003412235.1.84186 WP_003412235.1.84192 WP_003412235.1.84228 WP_003412235.1.8424 WP_003412235.1.84244 WP_003412235.1.84259 WP_003412235.1.8426 WP_003412235.1.84277 WP_003412235.1.84287 WP_003412235.1.8434 WP_003412235.1.84388 WP_003412235.1.84408 WP_003412235.1.84409 WP_003412235.1.84438 WP_003412235.1.84460 WP_003412235.1.84488 WP_003412235.1.84504 WP_003412235.1.84525 WP_003412235.1.84620 WP_003412235.1.84623 WP_003412235.1.84641 WP_003412235.1.84655 WP_003412235.1.84666 WP_003412235.1.84670 WP_003412235.1.84739 WP_003412235.1.84748 WP_003412235.1.84766 WP_003412235.1.84772 WP_003412235.1.84774 WP_003412235.1.848 WP_003412235.1.84812 WP_003412235.1.84836 WP_003412235.1.84839 WP_003412235.1.84846 WP_003412235.1.84873 WP_003412235.1.84911 WP_003412235.1.84938 WP_003412235.1.84968 WP_003412235.1.84973 WP_003412235.1.84981 WP_003412235.1.84985 WP_003412235.1.8503 WP_003412235.1.85038 WP_003412235.1.85041 WP_003412235.1.85043 WP_003412235.1.8505 WP_003412235.1.85074 WP_003412235.1.8509 WP_003412235.1.8512 WP_003412235.1.85148 WP_003412235.1.8518 WP_003412235.1.85242 WP_003412235.1.85276 WP_003412235.1.85281 WP_003412235.1.85284 WP_003412235.1.85314 WP_003412235.1.85319 WP_003412235.1.85330 WP_003412235.1.85341 WP_003412235.1.85346 WP_003412235.1.8535 WP_003412235.1.85363 WP_003412235.1.85371 WP_003412235.1.85377 WP_003412235.1.85399 WP_003412235.1.85458 WP_003412235.1.8546 WP_003412235.1.85464 WP_003412235.1.85478 WP_003412235.1.85480 WP_003412235.1.85488 WP_003412235.1.85495 WP_003412235.1.85551 WP_003412235.1.85557 WP_003412235.1.85577 WP_003412235.1.85597 WP_003412235.1.85599 WP_003412235.1.85610 WP_003412235.1.8563 WP_003412235.1.85648 WP_003412235.1.85679 WP_003412235.1.85704 WP_003412235.1.85717 WP_003412235.1.85737 WP_003412235.1.85763 WP_003412235.1.85808 WP_003412235.1.85819 WP_003412235.1.85820 WP_003412235.1.85823 WP_003412235.1.85832 WP_003412235.1.8586 WP_003412235.1.85894 WP_003412235.1.85913 WP_003412235.1.85953 WP_003412235.1.85986 WP_003412235.1.86000 WP_003412235.1.86024 WP_003412235.1.86025 WP_003412235.1.86032 WP_003412235.1.86048 WP_003412235.1.86052 WP_003412235.1.86067 WP_003412235.1.86103 WP_003412235.1.86122 WP_003412235.1.86124 WP_003412235.1.86160 WP_003412235.1.86164 WP_003412235.1.86168 WP_003412235.1.86190 WP_003412235.1.86204 WP_003412235.1.86208 WP_003412235.1.86235 WP_003412235.1.86249 WP_003412235.1.86260 WP_003412235.1.86290 WP_003412235.1.863 WP_003412235.1.86327 WP_003412235.1.86334 WP_003412235.1.86337 WP_003412235.1.86368 WP_003412235.1.86377 WP_003412235.1.86425 WP_003412235.1.86459 WP_003412235.1.86499 WP_003412235.1.86520 WP_003412235.1.86561 WP_003412235.1.86568 WP_003412235.1.86575 WP_003412235.1.86584 WP_003412235.1.86626 WP_003412235.1.86648 WP_003412235.1.8666 WP_003412235.1.86684 WP_003412235.1.86696 WP_003412235.1.86705 WP_003412235.1.86718 WP_003412235.1.86725 WP_003412235.1.86766 WP_003412235.1.86801 WP_003412235.1.86814 WP_003412235.1.86820 WP_003412235.1.86825 WP_003412235.1.86834 WP_003412235.1.8685 WP_003412235.1.86851 WP_003412235.1.86855 WP_003412235.1.86867 WP_003412235.1.86883 WP_003412235.1.86892 WP_003412235.1.86933 WP_003412235.1.86941 WP_003412235.1.86950 WP_003412235.1.86962 WP_003412235.1.86963 WP_003412235.1.86979 WP_003412235.1.8700 WP_003412235.1.87001 WP_003412235.1.87002 WP_003412235.1.87116 WP_003412235.1.8714 WP_003412235.1.87162 WP_003412235.1.87178 WP_003412235.1.87191 WP_003412235.1.87201 WP_003412235.1.87209 WP_003412235.1.87240 WP_003412235.1.87266 WP_003412235.1.87273 WP_003412235.1.87275 WP_003412235.1.8733 WP_003412235.1.87345 WP_003412235.1.87369 WP_003412235.1.8737 WP_003412235.1.87401 WP_003412235.1.87404 WP_003412235.1.87406 WP_003412235.1.87409 WP_003412235.1.87444 WP_003412235.1.87446 WP_003412235.1.87459 WP_003412235.1.87472 WP_003412235.1.87489 WP_003412235.1.87494 WP_003412235.1.87496 WP_003412235.1.87582 WP_003412235.1.87588 WP_003412235.1.87617 WP_003412235.1.87619 WP_003412235.1.87620 WP_003412235.1.87634 WP_003412235.1.87643 WP_003412235.1.8765 WP_003412235.1.87650 WP_003412235.1.87654 WP_003412235.1.87658 WP_003412235.1.87665 WP_003412235.1.87676 WP_003412235.1.87677 WP_003412235.1.87684 WP_003412235.1.87692 WP_003412235.1.87707 WP_003412235.1.87732 WP_003412235.1.87784 WP_003412235.1.87796 WP_003412235.1.87809 WP_003412235.1.87817 WP_003412235.1.87827 WP_003412235.1.87831 WP_003412235.1.87835 WP_003412235.1.87837 WP_003412235.1.87866 WP_003412235.1.8789 WP_003412235.1.87911 WP_003412235.1.87924 WP_003412235.1.87951 WP_003412235.1.87955 WP_003412235.1.87956 WP_003412235.1.87991 WP_003412235.1.88002 WP_003412235.1.88037 WP_003412235.1.88039 WP_003412235.1.88072 WP_003412235.1.88077 WP_003412235.1.88121 WP_003412235.1.88180 WP_003412235.1.88191 WP_003412235.1.88205 WP_003412235.1.88217 WP_003412235.1.88219 WP_003412235.1.88245 WP_003412235.1.88253 WP_003412235.1.88294 WP_003412235.1.88315 WP_003412235.1.88316 WP_003412235.1.88320 WP_003412235.1.88338 WP_003412235.1.8840 WP_003412235.1.88437 WP_003412235.1.88453 WP_003412235.1.88469 WP_003412235.1.88489 WP_003412235.1.88507 WP_003412235.1.88521 WP_003412235.1.88530 WP_003412235.1.88537 WP_003412235.1.88541 WP_003412235.1.88592 WP_003412235.1.88616 WP_003412235.1.88618 WP_003412235.1.8862 WP_003412235.1.88625 WP_003412235.1.88632 WP_003412235.1.88634 WP_003412235.1.88649 WP_003412235.1.8870 WP_003412235.1.88737 WP_003412235.1.88756 WP_003412235.1.88824 WP_003412235.1.88886 WP_003412235.1.88965 WP_003412235.1.88985 WP_003412235.1.8902 WP_003412235.1.89025 WP_003412235.1.89041 WP_003412235.1.89046 WP_003412235.1.89082 WP_003412235.1.89162 WP_003412235.1.89168 WP_003412235.1.8917 WP_003412235.1.89193 WP_003412235.1.89205 WP_003412235.1.89207 WP_003412235.1.89225 WP_003412235.1.8925 WP_003412235.1.89277 WP_003412235.1.89286 WP_003412235.1.89320 WP_003412235.1.8935 WP_003412235.1.89378 WP_003412235.1.89392 WP_003412235.1.89406 WP_003412235.1.8943 WP_003412235.1.89451 WP_003412235.1.89473 WP_003412235.1.89475 WP_003412235.1.89483 WP_003412235.1.895 WP_003412235.1.89513 WP_003412235.1.89517 WP_003412235.1.89522 WP_003412235.1.8954 WP_003412235.1.89543 WP_003412235.1.89567 WP_003412235.1.8957 WP_003412235.1.89572 WP_003412235.1.89589 WP_003412235.1.89607 WP_003412235.1.89613 WP_003412235.1.89625 WP_003412235.1.89648 WP_003412235.1.8967 WP_003412235.1.89670 WP_003412235.1.89676 WP_003412235.1.89729 WP_003412235.1.89739 WP_003412235.1.89762 WP_003412235.1.8977 WP_003412235.1.89802 WP_003412235.1.89808 WP_003412235.1.8982 WP_003412235.1.89829 WP_003412235.1.89831 WP_003412235.1.89844 WP_003412235.1.89849 WP_003412235.1.8989 WP_003412235.1.89901 WP_003412235.1.89903 WP_003412235.1.89909 WP_003412235.1.8992 WP_003412235.1.89922 WP_003412235.1.89963 WP_003412235.1.89971 WP_003412235.1.8998 WP_003412235.1.89987 WP_003412235.1.900 WP_003412235.1.90048 WP_003412235.1.9007 WP_003412235.1.90080 WP_003412235.1.90130 WP_003412235.1.90134 WP_003412235.1.90137 WP_003412235.1.90157 WP_003412235.1.90184 WP_003412235.1.90199 WP_003412235.1.90231 WP_003412235.1.90245 WP_003412235.1.90308 WP_003412235.1.90322 WP_003412235.1.90328 WP_003412235.1.90372 WP_003412235.1.90439 WP_003412235.1.90481 WP_003412235.1.90499 WP_003412235.1.9050 WP_003412235.1.90527 WP_003412235.1.90550 WP_003412235.1.90560 WP_003412235.1.90612 WP_003412235.1.90640 WP_003412235.1.90672 WP_003412235.1.90687 WP_003412235.1.90691 WP_003412235.1.90711 WP_003412235.1.90722 WP_003412235.1.90744 WP_003412235.1.9075 WP_003412235.1.90756 WP_003412235.1.90767 WP_003412235.1.90771 WP_003412235.1.90785 WP_003412235.1.90788 WP_003412235.1.90800 WP_003412235.1.90810 WP_003412235.1.90816 WP_003412235.1.90819 WP_003412235.1.9082 WP_003412235.1.90831 WP_003412235.1.90884 WP_003412235.1.90899 WP_003412235.1.90906 WP_003412235.1.90958 WP_003412235.1.90976 WP_003412235.1.90977 WP_003412235.1.90987 WP_003412235.1.9102 WP_003412235.1.91026 WP_003412235.1.91032 WP_003412235.1.91043 WP_003412235.1.91053 WP_003412235.1.91082 WP_003412235.1.91106 WP_003412235.1.91112 WP_003412235.1.91144 WP_003412235.1.91151 WP_003412235.1.91157 WP_003412235.1.91167 WP_003412235.1.91169 WP_003412235.1.91192 WP_003412235.1.91201 WP_003412235.1.91207 WP_003412235.1.91208 WP_003412235.1.91211 WP_003412235.1.91214 WP_003412235.1.91230 WP_003412235.1.91251 WP_003412235.1.91260 WP_003412235.1.91265 WP_003412235.1.9128 WP_003412235.1.91284 WP_003412235.1.91294 WP_003412235.1.91322 WP_003412235.1.91352 WP_003412235.1.91386 WP_003412235.1.9139 WP_003412235.1.91398 WP_003412235.1.91411 WP_003412235.1.91430 WP_003412235.1.91436 WP_003412235.1.91483 WP_003412235.1.91507 WP_003412235.1.91508 WP_003412235.1.91576 WP_003412235.1.91589 WP_003412235.1.91694 WP_003412235.1.91716 WP_003412235.1.91717 WP_003412235.1.91743 WP_003412235.1.91759 WP_003412235.1.91784 WP_003412235.1.91785 WP_003412235.1.91786 WP_003412235.1.91802 WP_003412235.1.91822 WP_003412235.1.91828 WP_003412235.1.9189 WP_003412235.1.91896 WP_003412235.1.9190 WP_003412235.1.91915 WP_003412235.1.91931 WP_003412235.1.91953 WP_003412235.1.91957 WP_003412235.1.91976 WP_003412235.1.91978 WP_003412235.1.92021 WP_003412235.1.92083 WP_003412235.1.92127 WP_003412235.1.92144 WP_003412235.1.92150 WP_003412235.1.92153 WP_003412235.1.92190 WP_003412235.1.92192 WP_003412235.1.92200 WP_003412235.1.92220 WP_003412235.1.92221 WP_003412235.1.92222 WP_003412235.1.92273 WP_003412235.1.92289 WP_003412235.1.9229 WP_003412235.1.92294 WP_003412235.1.92300 WP_003412235.1.92317 WP_003412235.1.92334 WP_003412235.1.92338 WP_003412235.1.92345 WP_003412235.1.92356 WP_003412235.1.92364 WP_003412235.1.92380 WP_003412235.1.92416 WP_003412235.1.92428 WP_003412235.1.92447 WP_003412235.1.92456 WP_003412235.1.92467 WP_003412235.1.92471 WP_003412235.1.92490 WP_003412235.1.92508 WP_003412235.1.9251 WP_003412235.1.92511 WP_003412235.1.92523 WP_003412235.1.92527 WP_003412235.1.92536 WP_003412235.1.92597 WP_003412235.1.92603 WP_003412235.1.92606 WP_003412235.1.92610 WP_003412235.1.92613 WP_003412235.1.9263 WP_003412235.1.9265 WP_003412235.1.92650 WP_003412235.1.92677 WP_003412235.1.92685 WP_003412235.1.92689 WP_003412235.1.92706 WP_003412235.1.92714 WP_003412235.1.92736 WP_003412235.1.9274 WP_003412235.1.92752 WP_003412235.1.92760 WP_003412235.1.92777 WP_003412235.1.92803 WP_003412235.1.92833 WP_003412235.1.92856 WP_003412235.1.92881 WP_003412235.1.92892 WP_003412235.1.92907 WP_003412235.1.92908 WP_003412235.1.9291 WP_003412235.1.92917 WP_003412235.1.92996 WP_003412235.1.93006 WP_003412235.1.93008 WP_003412235.1.93009 WP_003412235.1.93015 WP_003412235.1.93043 WP_003412235.1.9307 WP_003412235.1.93083 WP_003412235.1.93097 WP_003412235.1.93137 WP_003412235.1.93192 WP_003412235.1.93199 WP_003412235.1.93203 WP_003412235.1.93212 WP_003412235.1.93234 WP_003412235.1.93245 WP_003412235.1.93257 WP_003412235.1.93297 WP_003412235.1.93320 WP_003412235.1.93328 WP_003412235.1.93337 WP_003412235.1.93343 WP_003412235.1.93349 WP_003412235.1.93363 WP_003412235.1.93377 WP_003412235.1.9338 WP_003412235.1.93407 WP_003412235.1.93417 WP_003412235.1.93419 WP_003412235.1.93426 WP_003412235.1.9344 WP_003412235.1.93443 WP_003412235.1.93447 WP_003412235.1.93470 WP_003412235.1.93483 WP_003412235.1.93487 WP_003412235.1.93495 WP_003412235.1.93499 WP_003412235.1.93516 WP_003412235.1.93536 WP_003412235.1.93544 WP_003412235.1.93555 WP_003412235.1.93560 WP_003412235.1.93564 WP_003412235.1.9357 WP_003412235.1.93573 WP_003412235.1.93576 WP_003412235.1.93588 WP_003412235.1.9363 WP_003412235.1.93645 WP_003412235.1.93659 WP_003412235.1.93677 WP_003412235.1.9368 WP_003412235.1.93689 WP_003412235.1.93693 WP_003412235.1.93698 WP_003412235.1.93706 WP_003412235.1.9371 WP_003412235.1.93792 WP_003412235.1.93823 WP_003412235.1.93871 WP_003412235.1.9388 WP_003412235.1.93894 WP_003412235.1.93903 WP_003412235.1.93907 WP_003412235.1.93913 WP_003412235.1.93946 WP_003412235.1.93950 WP_003412235.1.93953 WP_003412235.1.93954 WP_003412235.1.93988 WP_003412235.1.9407 WP_003412235.1.94143 WP_003412235.1.94154 WP_003412235.1.94184 WP_003412235.1.94204 WP_003412235.1.94205 WP_003412235.1.94226 WP_003412235.1.94231 WP_003412235.1.94256 WP_003412235.1.94261 WP_003412235.1.94281 WP_003412235.1.94292 WP_003412235.1.94297 WP_003412235.1.9431 WP_003412235.1.94326 WP_003412235.1.94339 WP_003412235.1.94392 WP_003412235.1.94416 WP_003412235.1.94421 WP_003412235.1.94456 WP_003412235.1.94470 WP_003412235.1.94480 WP_003412235.1.94495 WP_003412235.1.94511 WP_003412235.1.94512 WP_003412235.1.94525 WP_003412235.1.94528 WP_003412235.1.94564 WP_003412235.1.946 WP_003412235.1.94602 WP_003412235.1.94623 WP_003412235.1.94629 WP_003412235.1.9465 WP_003412235.1.94673 WP_003412235.1.94730 WP_003412235.1.94736 WP_003412235.1.94776 WP_003412235.1.9478 WP_003412235.1.94834 WP_003412235.1.94852 WP_003412235.1.94872 WP_003412235.1.9488 WP_003412235.1.94902 WP_003412235.1.94916 WP_003412235.1.94979 WP_003412235.1.94994 WP_003412235.1.94996 WP_003412235.1.94998 WP_003412235.1.95007 WP_003412235.1.95010 WP_003412235.1.95015 WP_003412235.1.95034 WP_003412235.1.95068 WP_003412235.1.95081 WP_003412235.1.95082 WP_003412235.1.9509 WP_003412235.1.95096 WP_003412235.1.95112 WP_003412235.1.95138 WP_003412235.1.9514 WP_003412235.1.95179 WP_003412235.1.95188 WP_003412235.1.95190 WP_003412235.1.95234 WP_003412235.1.95241 WP_003412235.1.95257 WP_003412235.1.95279 WP_003412235.1.9531 WP_003412235.1.95335 WP_003412235.1.95344 WP_003412235.1.9535 WP_003412235.1.95370 WP_003412235.1.95392 WP_003412235.1.95416 WP_003412235.1.95417 WP_003412235.1.95454 WP_003412235.1.95455 WP_003412235.1.95491 WP_003412235.1.95497 WP_003412235.1.95509 WP_003412235.1.95529 WP_003412235.1.95556 WP_003412235.1.95557 WP_003412235.1.95565 WP_003412235.1.95578 WP_003412235.1.95580 WP_003412235.1.95585 WP_003412235.1.95643 WP_003412235.1.95679 WP_003412235.1.95685 WP_003412235.1.957 WP_003412235.1.95724 WP_003412235.1.95727 WP_003412235.1.95730 WP_003412235.1.95735 WP_003412235.1.95758 WP_003412235.1.95772 WP_003412235.1.95797 WP_003412235.1.95839 WP_003412235.1.9585 WP_003412235.1.9590 WP_003412235.1.95902 WP_003412235.1.95908 WP_003412235.1.95924 WP_003412235.1.95926 WP_003412235.1.95953 WP_003412235.1.95958 WP_003412235.1.95964 WP_003412235.1.95973 WP_003412235.1.96006 WP_003412235.1.9602 WP_003412235.1.96036 WP_003412235.1.96062 WP_003412235.1.96098 WP_003412235.1.96146 WP_003412235.1.96166 WP_003412235.1.96171 WP_003412235.1.96182 WP_003412235.1.96204 WP_003412235.1.96230 WP_003412235.1.96235 WP_003412235.1.96242 WP_003412235.1.96245 WP_003412235.1.96254 WP_003412235.1.96259 WP_003412235.1.96286 WP_003412235.1.96313 WP_003412235.1.96318 WP_003412235.1.96345 WP_003412235.1.96360 WP_003412235.1.96373 WP_003412235.1.96456 WP_003412235.1.96486 WP_003412235.1.96560 WP_003412235.1.96569 WP_003412235.1.96573 WP_003412235.1.96575 WP_003412235.1.96576 WP_003412235.1.96611 WP_003412235.1.9667 WP_003412235.1.96681 WP_003412235.1.96726 WP_003412235.1.96733 WP_003412235.1.96742 WP_003412235.1.96754 WP_003412235.1.9678 WP_003412235.1.96832 WP_003412235.1.9685 WP_003412235.1.97008 WP_003412235.1.97009 WP_003412235.1.97056 WP_003412235.1.97084 WP_003412235.1.97087 WP_003412235.1.97094 WP_003412235.1.97096 WP_003412235.1.97099 WP_003412235.1.97108 WP_003412235.1.97113 WP_003412235.1.97122 WP_003412235.1.97129 WP_003412235.1.97136 WP_003412235.1.9716 WP_003412235.1.97176 WP_003412235.1.97222 WP_003412235.1.97223 WP_003412235.1.97237 WP_003412235.1.97242 WP_003412235.1.97270 WP_003412235.1.97283 WP_003412235.1.97296 WP_003412235.1.97325 WP_003412235.1.97330 WP_003412235.1.97366 WP_003412235.1.97376 WP_003412235.1.97380 WP_003412235.1.9739 WP_003412235.1.97462 WP_003412235.1.97519 WP_003412235.1.97535 WP_003412235.1.97540 WP_003412235.1.97546 WP_003412235.1.97550 WP_003412235.1.97568 WP_003412235.1.97577 WP_003412235.1.97584 WP_003412235.1.9759 WP_003412235.1.97591 WP_003412235.1.97596 WP_003412235.1.97609 WP_003412235.1.97618 WP_003412235.1.9763 WP_003412235.1.97669 WP_003412235.1.97673 WP_003412235.1.97700 WP_003412235.1.97701 WP_003412235.1.9773 WP_003412235.1.97730 WP_003412235.1.97740 WP_003412235.1.97751 WP_003412235.1.97754 WP_003412235.1.97797 WP_003412235.1.9782 WP_003412235.1.9784 WP_003412235.1.97888 WP_003412235.1.9795 WP_003412235.1.97951 WP_003412235.1.97958 WP_003412235.1.97966 WP_003412235.1.97977 WP_003412235.1.97979 WP_003412235.1.97995 WP_003412235.1.98018 WP_003412235.1.98034 WP_003412235.1.98052 WP_003412235.1.98071 WP_003412235.1.98072 WP_003412235.1.98113 WP_003412235.1.98114 WP_003412235.1.98128 WP_003412235.1.98181 WP_003412235.1.98188 WP_003412235.1.98189 WP_003412235.1.98213 WP_003412235.1.98225 WP_003412235.1.98291 WP_003412235.1.98335 WP_003412235.1.98350 WP_003412235.1.98395 WP_003412235.1.98412 WP_003412235.1.98441 WP_003412235.1.98443 WP_003412235.1.98462 WP_003412235.1.9848 WP_003412235.1.98482 WP_003412235.1.98486 WP_003412235.1.98488 WP_003412235.1.98503 WP_003412235.1.98516 WP_003412235.1.98524 WP_003412235.1.98536 WP_003412235.1.98541 WP_003412235.1.98566 WP_003412235.1.98576 WP_003412235.1.98590 WP_003412235.1.98594 WP_003412235.1.98599 WP_003412235.1.98629 WP_003412235.1.98645 WP_003412235.1.98646 WP_003412235.1.98649 WP_003412235.1.98656 WP_003412235.1.9867 WP_003412235.1.98674 WP_003412235.1.98697 WP_003412235.1.98701 WP_003412235.1.98739 WP_003412235.1.98749 WP_003412235.1.98765 WP_003412235.1.98770 WP_003412235.1.98777 WP_003412235.1.98802 WP_003412235.1.98838 WP_003412235.1.98850 WP_003412235.1.98906 WP_003412235.1.98935 WP_003412235.1.98948 WP_003412235.1.98953 WP_003412235.1.98984 WP_003412235.1.99000 WP_003412235.1.99023 WP_003412235.1.99030 WP_003412235.1.99037 WP_003412235.1.99055 WP_003412235.1.99062 WP_003412235.1.99086 WP_003412235.1.99115 WP_003412235.1.99117 WP_003412235.1.99161 WP_003412235.1.99176 WP_003412235.1.99205 WP_003412235.1.99211 WP_003412235.1.99222 WP_003412235.1.99251 WP_003412235.1.99269 WP_003412235.1.99294 WP_003412235.1.99316 WP_003412235.1.99322 WP_003412235.1.99328 WP_003412235.1.99365 WP_003412235.1.99368 WP_003412235.1.99379 WP_003412235.1.99396 WP_003412235.1.99402 WP_003412235.1.99404 WP_003412235.1.99419 WP_003412235.1.99438 WP_003412235.1.99468 WP_003412235.1.99473 WP_003412235.1.99513 WP_003412235.1.99529 WP_003412235.1.99548 WP_003412235.1.99572 WP_003412235.1.99575 WP_003412235.1.99578 WP_003412235.1.99605 WP_003412235.1.99609 WP_003412235.1.99635 WP_003412235.1.99650 WP_003412235.1.99672 WP_003412235.1.99701 WP_003412235.1.99711 WP_003412235.1.99716 WP_003412235.1.99740 WP_003412235.1.99745 WP_003412235.1.99749 WP_003412235.1.9976 WP_003412235.1.99798 WP_003412235.1.99817 WP_003412235.1.99847 WP_003412235.1.99852 WP_003412235.1.99886 WP_003412235.1.99897 WP_003412235.1.99899 WP_003412235.1.99915 WP_003412235.1.9993 WP_003412235.1.99982 WP_003412235.1.99991 YP_177874.1.84033 233413.Mb2389c 336982.TBFG_12394 410289.BCG_2382c 419947.MRA_2392 478434.TBMG_04025 561275.JTY_2376 83331.MT2437 83332.Rv2368c gi|148662200|ref|YP_001283723.1| gi|433642563|ref|YP_007288322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]