SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338963.Pcar_2350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338963.Pcar_2350
Domain Number 1 Region: 314-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.69e-29
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.58e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 338963.Pcar_2350
Sequence length 520
Comment (Pelobacter carbinolicus)
Sequence
MSIEIQWIGIGAAFLVGAIGGALVRRKVAATQLAEAKRMADQILSEATKEADILRKEAEI
QKKDALLEAKTAWEQEAREMRRELQAQEKRLVQREENLDRKVAQVDARDEEFGQREKRLS
QQESRIRSWEKEADALVRQQRERLEELAGLGAEEAKAQLMEQMESEARHECAKKIKQIED
EAKEAADKKAQEILALAVQRYAGDFVAESAVSVVPLPNDEMKGRIIGREGRNIRAIEAAT
GIDLIIDDTPEAVIISGFNPVRREVARLALERLIGDGRIHPSRIEEAVNKATQDVDNAIR
EAGEQATFDVGVHGIHPEIIKLIGRLRYRTSYGQNVLQHSIEVAFLCGIMAAELGINVKQ
AKRAGLLHDIGKAVDHEVEGSHAVIGANLARKYGESAKIVHALAAHHEDEKPSTVLAVLV
QAADALSGARPGARREMLETYVKRLQDLERIGTSFAGVTNCYAIQAGREIRVMVSSEEVS
DVQSHTLAKQIARQIEEEMAYPGQIKINVIRETRAVEFAK
Download sequence
Identical sequences Q3A218
gi|404494003|ref|YP_006718109.1| 338963.Pcar_2350 WP_011342111.1.20986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]